Property Summary

NCBI Gene PubMed Count 20
Grant Count 4
R01 Count 1
Funding $541,138
PubMed Score 42.97
PubTator Score 14.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 0.040
pancreatic ductal adenocarcinoma liver m... -1.387 0.020
invasive ductal carcinoma -1.009 0.004
ovarian cancer 2.400 0.000

Synonym

Accession Q969X6 Q8NCD9 Q8TF14 Q96SP0 Q96SR9 Q96SZ9 Q96T13 Q9BWK6
Symbols NAIC
CIRH1A
CIRHIN
TEX292

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
19732766 Cirhin is a transcriptional regulatory factor of this NF-kappaB sequence and could be a participant in the regulation of other genes with NF-kappaB responsive elements.
16225863 Cirhin is a nucleolar protein and the R565W mutation, for which all North American Indian childhood cirrhosis patients are homozygous, has no effect on subcellular localization.
12417987 A missense mutation (R565W) in cirhin (FLJ14728) in North American Indian childhood cirrhosis

AA Sequence

MGEFKVHRVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHESRATEALCWAE      1 - 70
GQRLFSAGLNGEIMEYDLQALNIKYAMDAFGGPIWSMAASPSGSQLLVGCEDGSVKLFQITPDKIQFERN     71 - 140
FDRQKSRILSLSWHPSGTHIAAGSIDYISVFDVKSGSAVHKMIVDRQYMGVSKRKCIVWGVAFLSDGTII    141 - 210
SVDSAGKVQFWDSATGTLVKSHLIANADVQSIAVADQEDSFVVGTAEGTVFHFQLVPVTSNSSEKQWVRT    211 - 280
KPFQHHTHDVRTVAHSPTALISGGTDTHLVFRPLMEKVEVKNYDAALRKITFPHRCLISCSKKRQLLLFQ    281 - 350
FAHHLELWRLGSTVATGKNGDTLPLSKNADHLLHLKTKGPENIICSCISPCGSWIAYSTVSRFFLYRLNY    351 - 420
EHDNISLKRVSKMPAFLRSALQILFSEDSTKLFVASNQGALHIVQLSGGSFKHLHAFQPQSGTVEAMCLL    421 - 490
AVSPDGNWLAASGTSAGVHVYNVKQLKLHCTVPAYNFPVTAMAIAPNTNNLVIAHSDQQVFEYSIPDKQY    491 - 560
TDWSRTVQKQGFHHLWLQRDTPITHISFHPKRPMHILLHDAYMFCIIDKSLPLPNDKTLLYNPFPPTNES    561 - 630
DVIRRRTAHAFKISKIYKPLLFMDLLDERTLVAVERPLDDIIAQLPPPIKKKKFGT                  631 - 686
//

Text Mined References (20)

PMID Year Title
24219289 2013 Interaction, mobility, and phosphorylation of human orthologues of WD repeat-containing components of the yeast SSU processome t-UTP sub-complex.
22916032 2012 NOL11, implicated in the pathogenesis of North American Indian childhood cirrhosis, is required for pre-rRNA transcription and processing.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20385600 2010 The C-terminus of Utp4, mutated in childhood cirrhosis, is essential for ribosome biogenesis.
19732766 2009 Cirhin up-regulates a canonical NF-kappaB element through strong interaction with Cirip/HIVEP1.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16225863 2005 Nucleolar localization of cirhin, the protein mutated in North American Indian childhood cirrhosis.
15768832 2004 Molecular basis of intrahepatic cholestasis.
More...