Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.06
PubTator Score 1.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 8.6e-07
glioblastoma 1.100 1.6e-03
interstitial lung disease -2.100 5.2e-03
invasive ductal carcinoma 1.300 1.4e-03
juvenile dermatomyositis 1.216 7.3e-10
osteosarcoma -1.645 6.3e-04
ovarian cancer 1.800 3.6e-05
pancreatic ductal adenocarcinoma liver m... -1.625 3.0e-03
Pneumonia 1.200 3.7e-02
Rheumatoid arthritis 1.300 1.3e-02

Gene RIF (8)

AA Sequence

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDDPDKDSGGKID      1 - 70
VSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQ     71 - 140
PQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYT    141 - 210
VANKEYVAYSHTGRIIPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEA    211 - 280
WKKIQLGKMH                                                                281 - 290
//

Text Mined References (19)

PMID Year Title