Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.89
PubTator Score 1.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.013
interstitial lung disease -2.100 0.005
osteosarcoma -1.645 0.001
glioblastoma 1.100 0.002
juvenile dermatomyositis 1.216 0.000
pancreatic ductal adenocarcinoma liver m... -1.625 0.003
pilocytic astrocytoma 1.400 0.000
Pneumonia 1.200 0.037
invasive ductal carcinoma 1.300 0.001
ovarian cancer 1.800 0.000

Synonym

Accession Q969X5 Q9H0L0 Q9H2J2 Q9ULN9
Symbols NET24
ERGIC32
ERGIC-32

Gene

Gene RIF (7)

PMID Text
22761906 AIM1, ERGIC1, and TPX2 were shown to be highly expressed especially in prostate cancer tissues, and high mRNA expression of ERGIC1 and TMED3 associated with AR and ERG oncogene expression
22190034 HIV-1 Nef is identified to have a physical interaction with endoplasmic reticulum-golgi intermediate compartment 1 (ERGIC1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
15308636 ERGIC-32 functions as a modulator of the hErv41-hErv46 complex by stabilizing hErv46

AA Sequence

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDDPDKDSGGKID      1 - 70
VSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQ     71 - 140
PQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYT    141 - 210
VANKEYVAYSHTGRIIPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEA    211 - 280
WKKIQLGKMH                                                                281 - 290
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22761906 2012 High-throughput transcriptomic and RNAi analysis identifies AIM1, ERGIC1, TMED3 and TPX2 as potential drug targets in prostate cancer.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19946888 2010 Defining the membrane proteome of NK cells.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
More...