Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.24
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.500 9.3e-06
astrocytic glioma -1.400 1.2e-02
Astrocytoma, Pilocytic -1.200 6.3e-08
atypical teratoid / rhabdoid tumor -1.700 1.5e-09
ependymoma -1.300 3.4e-02
fibroadenoma -1.200 4.2e-03
glioblastoma -1.300 5.9e-09
group 3 medulloblastoma -1.700 2.0e-05
intraductal papillary-mucinous neoplasm ... -1.200 7.8e-03
invasive ductal carcinoma -1.200 8.9e-03
lung adenocarcinoma -1.500 3.3e-16
medulloblastoma, large-cell -2.500 2.2e-07
non-small cell lung cancer -1.141 3.7e-27
oligodendroglioma -1.200 2.3e-02
primitive neuroectodermal tumor -1.600 3.1e-06

Gene RIF (2)

AA Sequence

MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHY      1 - 70
GSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPT     71 - 140
TGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNM    141 - 210
EAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMP    211 - 280
YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT                     281 - 333
//

Text Mined References (13)

PMID Year Title