Property Summary

NCBI Gene PubMed Count 9
Grant Count 3
R01 Count 3
Funding $243,843.75
PubMed Score 3.07
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.400 0.012
ependymoma -1.300 0.034
oligodendroglioma -1.200 0.023
glioblastoma -1.300 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.600 0.000
non-small cell lung cancer -1.141 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.008
fibroadenoma -1.200 0.004
adult high grade glioma -1.500 0.000
pilocytic astrocytoma -1.200 0.000
lung adenocarcinoma -1.500 0.000
invasive ductal carcinoma -1.200 0.009

Synonym

Accession Q969X2 B3KQ01 Q5T9C4 Q5T9C5 Q9H8A2 Q9ULB8
Symbols SIAT7F
SIAT7-F
ST6GALNACVI

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
17123352 ST6GalNAc-VI and disialylgalactosylgloboside were found in proximal tubule epithelial cells in normal kidney tissues
12668675 novel substrate specificity of ST6GalNAc VI, which is responsible for the synthesis of disialyl Lea but not for alpha-series gangliosides in human colon tissues

AA Sequence

MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHY      1 - 70
GSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPT     71 - 140
TGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNM    141 - 210
EAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMP    211 - 280
YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT                     281 - 333
//

Text Mined References (13)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
17760270 Carbohydrate antigen sialyl Lewis a--its pathophysiological significance and induction mechanism in cancer progression.
17123352 2007 Identification and expression of a sialyltransferase responsible for the synthesis of disialylgalactosylgloboside in normal and malignant kidney cells: downregulation of ST6GalNAc VI in renal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16207893 2006 Identification of linkage-specific sequence motifs in sialyltransferases.
15843597 2005 The animal sialyltransferases and sialyltransferase-related genes: a phylogenetic approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...