Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
Funding $83,694
PubMed Score 4.31
PubTator Score 4.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q969X1 B3KQY6 Q8N1R3 Q8TAM3 Q96K13
Symbols LFG3
RECS1
MST100
PP1201
MSTP100

Gene

 Grant Application (1)

 GO Function (1)

Gene RIF (3)

PMID Text
25764978 These results suggest that the TMBIM family has comparable functions in the maintenance of intracellular Ca(2) homeostasis in a wide variety of tissues
21107705 data suggest that PP1201 functions as an anti-apoptotic protein and its increased expression in vascular cells can contribute to homeostasis by reducing Fas trafficking to the cell membrane
18440869 The tmbim1 may participate in cell death regulation by interacting with proteins of Bcl-2 family, promoting tumor metastasis, which is deduced from the evolutionary conservation of the membrane protein family containing multiple membrane spanning segments

AA Sequence

MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPG      1 - 70
HGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIFTFVEPVSAFVRRNVAVYYVS     71 - 140
YAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTGTISSMYQTKAVIIAMIITAVVSISVTIFCF    141 - 210
QTKVDFTSCTGLFCVLGIVLLVTGIVTSIVLYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTI    211 - 280
SPEDYITGALQIYTDIIYIFTFVLQLMGDRN                                           281 - 311
//

Text Mined References (20)

PMID Year Title
25764978 2015 The transmembrane Bax inhibitor motif (TMBIM) containing protein family: Tissue expression, intracellular localization and effects on the ER CA²?-filling state.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21107705 2011 A shear stress responsive gene product PP1201 protects against Fas-mediated apoptosis by reducing Fas expression on the cell surface.
19784873 2009 LFG: a candidate apoptosis regulatory gene family.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18440869 2008 Comparative genomics and function analysis on BI1 family.
18088087 2008 Phosphoproteome of resting human platelets.
More...