Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.67
PubTator Score 4.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q969X1 B3KQY6 Q8N1R3 Q8TAM3 Q96K13
Symbols LFG3
RECS1
MST100
PP1201
MSTP100

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (5)

AA Sequence

MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPG      1 - 70
HGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIFTFVEPVSAFVRRNVAVYYVS     71 - 140
YAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTGTISSMYQTKAVIIAMIITAVVSISVTIFCF    141 - 210
QTKVDFTSCTGLFCVLGIVLLVTGIVTSIVLYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTI    211 - 280
SPEDYITGALQIYTDIIYIFTFVLQLMGDRN                                           281 - 311
//

Text Mined References (22)

PMID Year Title