Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.14
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.717 4.7e-03
active ulcerative colitis 1.944 6.2e-04
acute myeloid leukemia 1.100 1.9e-02
group 3 medulloblastoma -1.100 3.1e-02
lung adenocarcinoma -1.200 3.1e-16
lung carcinoma -1.200 5.4e-19
medulloblastoma, large-cell -1.700 1.7e-04
non-small cell lung cancer -1.278 8.5e-27
osteosarcoma -1.665 1.8e-06
ovarian cancer -1.900 1.4e-06

AA Sequence

MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVR      1 - 70
VLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRD     71 - 140
VLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQ    141 - 210
T//

Text Mined References (13)

PMID Year Title