Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.08
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.665 0.000
medulloblastoma, large-cell -1.700 0.000
non-small cell lung cancer -1.278 0.000
active Crohn's disease 1.717 0.005
ulcerative colitis 2.200 0.000
lung adenocarcinoma -1.400 0.000
group 4 medulloblastoma -1.500 0.000
lung carcinoma -1.200 0.000
acute myeloid leukemia 1.100 0.019
ovarian cancer -1.900 0.000

Synonym

Accession Q969X0
Symbols RLP2

Gene

PANTHER Protein Class (1)

AA Sequence

MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVR      1 - 70
VLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRD     71 - 140
VLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQ    141 - 210
T//

Text Mined References (13)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24136289 2013 Identification and comparative analysis of hepatitis C virus-host cell protein interactions.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...