Property Summary

NCBI Gene PubMed Count 29
Grant Count 3
R01 Count 3
Funding $95,016.6
PubMed Score 20.89
PubTator Score 25.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q969W9 Q5TDR6 Q8NER4 Q96B72 Q9UJD3
Symbols STAG1
TMEPAI

Gene

Gene RIF (17)

PMID Text
26927372 Data show that over-expressed transmembrane prostate androgen-induced protein 1 (PMEPA1) can promote cell migration and maintain the mesenchymal-like morphology of breast cancer cells.
26758191 PMEPA1 was upregulated in breast cancer cell lines as well as in a set of clinical invasive breast ductal carcinomas. Interestingly, depletion of PMEPA1 decreased breast cancer stem cell (CSC)-enriched populations, while ectopic overexpression of PMEPA1 increased breast CSC-enriched populations.
26590303 these data elaborated on the diverse activity among TCF/LEF family members with respect to the transcriptional regulation of the TMEPAI gene.
25883222 Data show that silencing of PMEPA1 protein facilitates the growth of prostate cancer cells and modulates androgen receptor (AR) through NEDD4 ubiquitin protein ligase and PTEN protein.
25482449 EGF signaling collaboratively regulates TGF-beta-induced TMEPAI expression.
24933703 TMEPAI is translocated on the lysosome and late endosome, and that association with Nedd4 is required for the transport of TMEPAI to the lysosome.
24694733 Downregulation of PMEPA1 may result in increased androgen receptor protein levels and function in cancer of the prostate cells, contributing to prostate tumorigenesis.
24438557 TMEPAI promotes tumorigenic activities in lung cancer cells.
23615405 The levels of TMEPAI in lung tumor tissues are very high.
23284715 The yeast two-hybrid screen identifies the HIV-1 Nef interacting human protein prostate transmembrane protein, androgen induced 1 (PMEPA1) in cells
More...

AA Sequence

MHRLMGVNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELEFVQIIIIVVVMMVMVVVITCLLSHYKLSAR      1 - 70
SFISRHSQGRRREDALSSEGCLWPSESTVSGNGIPEPQVYAPPRPTDRLAVPPFAQRERFHRFQPTYPYL     71 - 140
QHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLMDSARLGGPCPPSS    141 - 210
NSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKD    211 - 280
KQKGHPL                                                                   281 - 287
//

Text Mined References (29)

PMID Year Title
26927372 2016 [Transmembrane prostate androgen-induced protein 1 (PMEPA1) promotes the migration and maintains mesenchymal-like phenotype of breast cancer cells].
26758191 2016 Transforming growth factor-beta increases breast cancer stem cell population partially through upregulating PMEPA1 expression.
26590303 2016 Regulation of the TMEPAI promoter by TCF7L2: the C-terminal tail of TCF7L2 is essential to activate the TMEPAI gene.
25883222 2015 Silencing of PMEPA1 accelerates the growth of prostate cancer cells through AR, NEDD4 and PTEN.
25482449 2015 Cooperative induction of transmembrane prostate androgen induced protein TMEPAI/PMEPA1 by transforming growth factor-? and epidermal growth factor signaling.
24933703 2014 TMEPAI inhibits TGF-? signaling by promoting lysosome degradation of TGF-? receptor and contributes to lung cancer development.
24694733 2014 Methylation of the PMEPA1 gene, a negative regulator of the androgen receptor in prostate cancer.
24627487 2014 C18 ORF1, a novel negative regulator of transforming growth factor-? signaling.
24438557 2014 TMEPAI/PMEPA1 enhances tumorigenic activities in lung cancer cells.
23615405 2013 TMEPAI regulates EMT in lung cancer cells by modulating the ROS and IRS-1 signaling pathways.
More...