Property Summary

NCBI Gene PubMed Count 87
PubMed Score 316.30
PubTator Score 88.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Malignant neoplasm of breast 63
Disease Target Count P-value
posterior fossa group B ependymoma 1530 7.35972344428393E-9
malignant mesothelioma 3163 2.72021576367754E-6
osteosarcoma 7933 3.15810996420383E-6
ovarian cancer 8492 2.52352502452197E-5
psoriasis 6685 6.01715438337608E-4
cutaneous lupus erythematosus 1056 7.99058346762216E-4
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.419 1.7
Disease Target Count Z-score Confidence
Endocarditis 18 4.451 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
cutaneous lupus erythematosus 1.400 0.001
psoriasis 1.200 0.001
osteosarcoma -1.553 0.000
posterior fossa group B ependymoma -1.100 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q969V6 Q8TCL1 Q96SC5 Q96SC6 Q9P2B0
Symbols MAL
BSAC
MRTF-A

Gene

PANTHER Protein Class (1)

PDB

2KVU   2KW9  

  Ortholog (11)

Gene RIF (61)

PMID Text
27088725 Redox-sensitive regulation of MRTF-A phosphorylation via palladin in vascular smooth muscle cell differentiation marker gene expression.
26554816 FLNA functions as a positive cellular transducer linking actin polymerization to MKL1-SRF activity, counteracting the known repressive complex of MKL1 and monomeric G-actin.
26498848 Study showed that MRTF-A and MRTF-B were upregulated in pancreatic cancer tissues supporting the hypothesis that both of them are oncogenes in pancreatic cancer.
26476216 p300 and MRTF-A synergistically enhance the expression of migration-related genes in breast cancer cells.
26459764 Myocardin-Related Transcription Factor A and Yes-Associated Protein Exert Dual Control in G protein-coupled receptor- and RhoA-mediated transcriptional regulation and cell proliferation
26295164 MRTF-A is a critical for epithelial to mesenchymal transition and can be stereoselectively inhibited by CCG-1423.
26224645 MKL1 deficiency results in actin cytoskeletal disruption in myeloid and lymphoid cell lineages.
25999144 Identification of SAP-dependent Mkl1 signaling as a previously unrecognized mediator of aggressive progression of mammary tumors locally relapsing after radiotherapy.
25962701 AMPK and Akt activation are responsible for the CTRP6-mediated anti-fibrotic effect by targeting RhoA/MRTF-A pathway
25955685 Study found that MRTF-A expression was up-regulated in metastatic anaplastic thyroid cancer tissues and promoted metastasis-relevant traits in vitro.
More...

AA Sequence

MPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERSELVRMHILEETSAEPSLQAKQLKLKRARLADDL      1 - 70
NEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKVADSSSFDEDSSDALSPEQPASHESQGSVPSP     71 - 140
LEARVSEPLLSATSASPTQVVSQLPMGRDSREMLFLAEQPPLPPPPLLPPSLTNGTTIPTAKSTPTLIKQ    141 - 210
SQPKSASEKSQRSKKAKELKPKVKKLKYHQYIPPDQKQDRGAPPMDSSYAKILQQQQLFLQLQILNQQQQ    211 - 280
QHHNYQAILPAPPKSAGEALGSSGTPPVRSLSTTNSSSSSGAPGPCGLARQNSTSLTGKPGALPANLDDM    281 - 350
KVAELKQELKLRSLPVSGTKTELIERLRAYQDQISPVPGAPKAPAATSILHKAGEVVVAFPAARLSTGPA    351 - 420
LVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQ    421 - 490
ASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRMLRQKQQLVERLKLQLEQEKR    491 - 560
AQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQP    561 - 630
EPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAP    631 - 700
SAQMDLEHPLQPLFGTPTSLLKKEPPGYEEAMSQQPKQQENGSSSQQMDDLFDILIQSGEISADFKEPPS    701 - 770
LPGKEKPSPKTVCGSPLAAQPSPSAELPQAAPPPPGSPSLPGRLEDFLESSTGLPLLTSGHDGPEPLSLI    771 - 840
DDLHSQMLSSTAILDHPPSPMDTSELHFVPEPSSTMGLDLADGHLDSMDWLELSSGGPVLSLAPLSTTAP    841 - 910
SLFSTDFLDGHDLQLHWDSCL                                                     911 - 931
//

Text Mined References (95)

PMID Year Title
27088725 2016 Redox-Sensitive Regulation of Myocardin-Related Transcription Factor (MRTF-A) Phosphorylation via Palladin in Vascular Smooth Muscle Cell Differentiation Marker Gene Expression.
26554816 2015 Filamin A interacts with the coactivator MKL1 to promote the activity of the transcription factor SRF and cell migration.
26498848 2016 The MRTF-A/B function as oncogenes in pancreatic cancer.
26476216 2015 Transcriptional factors p300 and MRTF-A synergistically enhance the expression of migration-related genes in MCF-7 breast cancer cells.
26459764 2016 Myocardin-Related Transcription Factor A and Yes-Associated Protein Exert Dual Control in G Protein-Coupled Receptor- and RhoA-Mediated Transcriptional Regulation and Cell Proliferation.
26295164 2015 Stereospecific Inhibitory Effects of CCG-1423 on the Cellular Events Mediated by Myocardin-Related Transcription Factor A.
26224645 2015 Immunodeficiency and severe susceptibility to bacterial infection associated with a loss-of-function homozygous mutation of MKL1.
25999144 2015 Mechanism of irradiation-induced mammary cancer metastasis: A role for SAP-dependent Mkl1 signaling.
25962701 2015 C1q/tumor necrosis factor-related protein-6 attenuates post-infarct cardiac fibrosis by targeting RhoA/MRTF-A pathway and inhibiting myofibroblast differentiation.
25955685 2015 miR-206 inhibits metastasis-relevant traits by degrading MRTF-A in anaplastic thyroid cancer.
More...