Property Summary

NCBI Gene PubMed Count 101
PubMed Score 351.75
PubTator Score 88.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.4
Disease Target Count Z-score Confidence
Cancer 2499 3.552 1.8
Disease Target Count Z-score Confidence
Endocarditis 19 4.351 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 8.0e-04
malignant mesothelioma -1.500 2.7e-06
osteosarcoma 1.227 1.6e-06
ovarian cancer 1.200 2.5e-05
posterior fossa group B ependymoma -1.100 7.4e-09
psoriasis 1.200 6.0e-04

Protein-protein Interaction (1)

Gene RIF (75)

AA Sequence

MPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERSELVRMHILEETSAEPSLQAKQLKLKRARLADDL      1 - 70
NEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKVADSSSFDEDSSDALSPEQPASHESQGSVPSP     71 - 140
LEARVSEPLLSATSASPTQVVSQLPMGRDSREMLFLAEQPPLPPPPLLPPSLTNGTTIPTAKSTPTLIKQ    141 - 210
SQPKSASEKSQRSKKAKELKPKVKKLKYHQYIPPDQKQDRGAPPMDSSYAKILQQQQLFLQLQILNQQQQ    211 - 280
QHHNYQAILPAPPKSAGEALGSSGTPPVRSLSTTNSSSSSGAPGPCGLARQNSTSLTGKPGALPANLDDM    281 - 350
KVAELKQELKLRSLPVSGTKTELIERLRAYQDQISPVPGAPKAPAATSILHKAGEVVVAFPAARLSTGPA    351 - 420
LVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQ    421 - 490
ASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRMLRQKQQLVERLKLQLEQEKR    491 - 560
AQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQP    561 - 630
EPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAP    631 - 700
SAQMDLEHPLQPLFGTPTSLLKKEPPGYEEAMSQQPKQQENGSSSQQMDDLFDILIQSGEISADFKEPPS    701 - 770
LPGKEKPSPKTVCGSPLAAQPSPSAELPQAAPPPPGSPSLPGRLEDFLESSTGLPLLTSGHDGPEPLSLI    771 - 840
DDLHSQMLSSTAILDHPPSPMDTSELHFVPEPSSTMGLDLADGHLDSMDWLELSSGGPVLSLAPLSTTAP    841 - 910
SLFSTDFLDGHDLQLHWDSCL                                                     911 - 931
//

Text Mined References (109)

PMID Year Title