Property Summary

NCBI Gene PubMed Count 87
Grant Count 85
R01 Count 54
Funding $6,098,242.54
PubMed Score 316.30
PubTator Score 88.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
cutaneous lupus erythematosus 1.400 0.001
psoriasis 1.200 0.001
osteosarcoma -1.553 0.000
posterior fossa group B ependymoma -1.100 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q969V6 Q8TCL1 Q96SC5 Q96SC6 Q9P2B0
Symbols MAL
BSAC
MRTF-A

Gene

PANTHER Protein Class (1)

PDB

2KVU   2KW9  

Gene RIF (61)

PMID Text
27088725 Redox-sensitive regulation of MRTF-A phosphorylation via palladin in vascular smooth muscle cell differentiation marker gene expression.
26554816 FLNA functions as a positive cellular transducer linking actin polymerization to MKL1-SRF activity, counteracting the known repressive complex of MKL1 and monomeric G-actin.
26498848 Study showed that MRTF-A and MRTF-B were upregulated in pancreatic cancer tissues supporting the hypothesis that both of them are oncogenes in pancreatic cancer.
26476216 p300 and MRTF-A synergistically enhance the expression of migration-related genes in breast cancer cells.
26459764 Myocardin-Related Transcription Factor A and Yes-Associated Protein Exert Dual Control in G protein-coupled receptor- and RhoA-mediated transcriptional regulation and cell proliferation
26295164 MRTF-A is a critical for epithelial to mesenchymal transition and can be stereoselectively inhibited by CCG-1423.
26224645 MKL1 deficiency results in actin cytoskeletal disruption in myeloid and lymphoid cell lineages.
25999144 Identification of SAP-dependent Mkl1 signaling as a previously unrecognized mediator of aggressive progression of mammary tumors locally relapsing after radiotherapy.
25962701 AMPK and Akt activation are responsible for the CTRP6-mediated anti-fibrotic effect by targeting RhoA/MRTF-A pathway
25955685 Study found that MRTF-A expression was up-regulated in metastatic anaplastic thyroid cancer tissues and promoted metastasis-relevant traits in vitro.
More...

AA Sequence

MPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERSELVRMHILEETSAEPSLQAKQLKLKRARLADDL      1 - 70
NEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKVADSSSFDEDSSDALSPEQPASHESQGSVPSP     71 - 140
LEARVSEPLLSATSASPTQVVSQLPMGRDSREMLFLAEQPPLPPPPLLPPSLTNGTTIPTAKSTPTLIKQ    141 - 210
SQPKSASEKSQRSKKAKELKPKVKKLKYHQYIPPDQKQDRGAPPMDSSYAKILQQQQLFLQLQILNQQQQ    211 - 280
QHHNYQAILPAPPKSAGEALGSSGTPPVRSLSTTNSSSSSGAPGPCGLARQNSTSLTGKPGALPANLDDM    281 - 350
KVAELKQELKLRSLPVSGTKTELIERLRAYQDQISPVPGAPKAPAATSILHKAGEVVVAFPAARLSTGPA    351 - 420
LVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQ    421 - 490
ASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRMLRQKQQLVERLKLQLEQEKR    491 - 560
AQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQP    561 - 630
EPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAP    631 - 700
SAQMDLEHPLQPLFGTPTSLLKKEPPGYEEAMSQQPKQQENGSSSQQMDDLFDILIQSGEISADFKEPPS    701 - 770
LPGKEKPSPKTVCGSPLAAQPSPSAELPQAAPPPPGSPSLPGRLEDFLESSTGLPLLTSGHDGPEPLSLI    771 - 840
DDLHSQMLSSTAILDHPPSPMDTSELHFVPEPSSTMGLDLADGHLDSMDWLELSSGGPVLSLAPLSTTAP    841 - 910
SLFSTDFLDGHDLQLHWDSCL                                                     911 - 931
//

Text Mined References (95)

PMID Year Title
27088725 2016 Redox-Sensitive Regulation of Myocardin-Related Transcription Factor (MRTF-A) Phosphorylation via Palladin in Vascular Smooth Muscle Cell Differentiation Marker Gene Expression.
26554816 2015 Filamin A interacts with the coactivator MKL1 to promote the activity of the transcription factor SRF and cell migration.
26498848 2016 The MRTF-A/B function as oncogenes in pancreatic cancer.
26476216 2015 Transcriptional factors p300 and MRTF-A synergistically enhance the expression of migration-related genes in MCF-7 breast cancer cells.
26459764 2016 Myocardin-Related Transcription Factor A and Yes-Associated Protein Exert Dual Control in G Protein-Coupled Receptor- and RhoA-Mediated Transcriptional Regulation and Cell Proliferation.
26295164 2015 Stereospecific Inhibitory Effects of CCG-1423 on the Cellular Events Mediated by Myocardin-Related Transcription Factor A.
26224645 2015 Immunodeficiency and severe susceptibility to bacterial infection associated with a loss-of-function homozygous mutation of MKL1.
25999144 2015 Mechanism of irradiation-induced mammary cancer metastasis: A role for SAP-dependent Mkl1 signaling.
25962701 2015 C1q/tumor necrosis factor-related protein-6 attenuates post-infarct cardiac fibrosis by targeting RhoA/MRTF-A pathway and inhibiting myofibroblast differentiation.
25955685 2015 miR-206 inhibits metastasis-relevant traits by degrading MRTF-A in anaplastic thyroid cancer.
More...