Property Summary

NCBI Gene PubMed Count 33
Grant Count 7
R01 Count 6
Funding $637,929.03
PubMed Score 227.50
PubTator Score 46.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (18)

PMID Text
26435500 Hades (MUL1)-mediated p73 ubiquitination is a novel regulatory mechanism for the exonuclear function of p73.
26384664 Activation of apoptosis triggers MAPL/MUL1-dependent SUMOylation of the fission GTPase Drp1, a process requisite for cytochrome c release.
26203915 Cigarette smoke-induced MUL1 elevation mediates Akt ubiquitination/degradation, potentially leading to pulmonary endothelial cell death and functional impairment.
26018823 MUL1 ubiquitinates ULK1 and regulates selenite-induced mitophagy
25224329 The interaction of GABARAP with Mulan-Ube2E3 supports the role of Mulan as an important regulator of mitophagy.
25169519 MethyLight data demonstrated that C13orf18 and C1orf166 could not be considered as specific, sensitive and suitable prognostic biomarkers in cervical dysplasia related Papillomavirus Infections.
24841215 During stress-induced mitochondrial hyperfusion, MULAN forms a complex with TRAF2 and modulates its ubiquitylation, signifying that TRAF2 may serve as an ubiquitylated transmitter of NF-kappaB signaling in this pathway
23399697 MUL1 is a novel regulator of the RIG-I-like receptor-dependent antiviral response, that otherwise functions to limit inflammation.
22410793 MULAN negatively regulates Akt signaling, facilitating the control of multiple cellular processes.
21597459 These findings show that Hades (MUL1)-mediated p53 ubiquitination is a novel mechanism for negatively regulating the exonuclear function of p53
More...

AA Sequence

MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEG      1 - 70
AVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVR     71 - 140
VLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRL    141 - 210
QPPKQGMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQ    211 - 280
EHEAQLLSRAKPEDRESLKSACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLY    281 - 350
NS                                                                        351 - 352
//

Text Mined References (35)

PMID Year Title
26435500 2015 Ubiquitination-dependent degradation of p73 by the mitochondrial E3 ubiquitin ligase Hades.
26384664 2015 MAPL SUMOylation of Drp1 Stabilizes an ER/Mitochondrial Platform Required for Cell Death.
26203915 2016 Mitochondrial E3 Ubiquitin Protein Ligase 1 Mediates Cigarette Smoke-Induced Endothelial Cell Death and Dysfunction.
26018823 2015 Mitochondrial outer-membrane E3 ligase MUL1 ubiquitinates ULK1 and regulates selenite-induced mitophagy.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25416956 2014 A proteome-scale map of the human interactome network.
25224329 2014 Mulan E3 ubiquitin ligase interacts with multiple E2 conjugating enzymes and participates in mitophagy by recruiting GABARAP.
25169519 2014 C13orf18 and C1orf166 (MULAN) DNA genes methylation are not associated with cervical cancer and precancerous lesions of human papillomavirus genotypes in Iranian women.
24898855 2014 MUL1 acts in parallel to the PINK1/parkin pathway in regulating mitofusin and compensates for loss of PINK1/parkin.
24841215 2014 Mitochondrial hyperfusion promotes NF-?B activation via the mitochondrial E3 ligase MULAN.
More...