Property Summary

NCBI Gene PubMed Count 26
Grant Count 3
R01 Count 1
Funding $399,600
PubMed Score 82.46
PubTator Score 55.80

Knowledge Summary

Patent (14,023)

Synonym

Accession Q969V1 B3KVW4 E1P5D7 Q5VTV7 Q6Q377 Q9BXA8 MCH receptor 2
Symbols SLT
MCH2
MCH2R
GPR145
GPRv17
MCH-2R
MCH-R2
MCHR-2

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (12)

PMID Text
26461262 This study provides new insights on the possible influence of MCHR2 and/or MCHR2-AS1 on obesity in psychiatric patients and on the pathophysiology of atypical depression.
22123324 Discovery and characterization of a potent and selective antagonist of melanin-concentrating hormone receptor 2
20099459 construction of the CHO cell line and the research of MCHR2 molecular characteristics have established a good experimental basis for the further research about the function of MCHR2 gene
19927306 Observational study of gene-disease association. (HuGE Navigator)
19683862 MCHR2 positively mediates the regulation of melanin-concentrating hormone during preadipocyte differentiation and is involved in energy balance regulation without affecting preadipocyte proliferation.
19502010 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17698913 Observational study of gene-disease association. (HuGE Navigator)
17698913 MCHR2 is not a major contributor to polygenic obesity
15941924 Observational study of gene-disease association. (HuGE Navigator)
15229878 results of molecular simulations of MCHR2 in the free and hormone-bound forms provide suggestions on the amino acids responsible for the transfer of the structural changes from the agonist binding site to the G-protein coupling domains
More...

AA Sequence

MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTIIRSRKKTVPDI      1 - 70
YICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFACSAIMTVMSVDRYFALVQPFR     71 - 140
LTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDGVESCAFDLTSPDDVLWYTLYLTITTFFFPL    141 - 210
PLILVCYILILCYTWEMYQQNKDARCCNPSVPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQP    211 - 280
TLAFYVGYYLSICLSYASSSINPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF              281 - 340
//

Text Mined References (26)

PMID Year Title
26461262 2015 Influence of MCHR2 and MCHR2-AS1 Genetic Polymorphisms on Body Mass Index in Psychiatric Patients and In Population-Based Subjects with Present or Past Atypical Depression.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
22123324 2012 Discovery and characterization of a potent and selective antagonist of melanin-concentrating hormone receptor 2.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20099459 2009 Establishment of CHO cell line expressing human MCHR2 gene and research of its molecular characteristics.
19927306 2010 A systematic association mapping on chromosome 6q in bipolar affective disorder--evidence for the melanin-concentrating-hormone-receptor-2 gene as a risk factor for bipolar affective disorder.
19683862 2009 Melanin-concentrating hormone receptor 2 affects 3T3-L1 preadipocyte differentiation.
19502010 2009 Two complex genotypes relevant to the kynurenine pathway and melanotropin function show association with schizophrenia and bipolar disorder.
17698913 2007 Genetic study of the melanin-concentrating hormone receptor 2 in childhood and adulthood severe obesity.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
More...