Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.42
PubTator Score 33.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.284 0.007
Multiple myeloma 1.880 0.000
psoriasis 1.300 0.000
acute quadriplegic myopathy 1.070 0.000
ovarian cancer -1.500 0.000
dermatomyositis 1.300 0.000

Gene RIF (3)

PMID Text
18174230 Observational study of gene-disease association. (HuGE Navigator)
16251969 two chaperones, designated proteasome assembling chaperone-1 (PAC1) and PAC2, form a heterodimer and are involved in the maturation of mammalian 20S proteasomes
11854909 A novel full-length cDNA was cloned and differentiated, which was highly expressed in liver cancer tissues. (HCCA3)

AA Sequence

MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTE      1 - 70
LSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFR     71 - 140
YLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSE    141 - 210
GDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF                    211 - 264
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
18978792 2008 Meta-analysis of genome-wide association study data identifies additional type 1 diabetes risk loci.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
17707236 2007 20S proteasome assembly is orchestrated by two distinct pairs of chaperones in yeast and in mammals.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17554260 2007 Robust associations of four new chromosome regions from genome-wide analyses of type 1 diabetes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...