Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.17
PubTator Score 33.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute quadriplegic myopathy 1158 2.4e-06
ovarian cancer 8519 6.1e-06
Multiple myeloma 1332 4.1e-05
psoriasis 6694 8.8e-05
dermatomyositis 966 2.8e-04
Waldenstrons macroglobulinemia 765 7.0e-03
Disease Target Count Z-score Confidence
Neutropenia 72 3.155 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.070 2.4e-06
dermatomyositis 1.300 2.8e-04
Multiple myeloma 1.880 4.1e-05
ovarian cancer -1.500 6.1e-06
psoriasis 1.300 8.8e-05
Waldenstrons macroglobulinemia 1.284 7.0e-03

Synonym

Accession Q969U7 B0YJB3 Q6IAH4 Q9NRV1 V9GYH7 PAC-2
Symbols PAC2
HCCA3
CLAST3
MDS003
HsT1707
TNFSF5IP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTE      1 - 70
LSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFR     71 - 140
YLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSE    141 - 210
GDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF                    211 - 264
//

Text Mined References (20)

PMID Year Title