Property Summary

NCBI Gene PubMed Count 32
PubMed Score 14.00
PubTator Score 11.22

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (4)

AA Sequence

MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKEL      1 - 70
AEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINS     71 - 140
QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT       141 - 207
//

Text Mined References (36)

PMID Year Title