Property Summary

NCBI Gene PubMed Count 31
Grant Count 15
R01 Count 9
Funding $1,171,009.29
PubMed Score 13.89
PubTator Score 11.22

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (4)

PMID Text
25378586 Data indicate that ubiquitin-conjugating enzyme UBE2E3 and importin 11 (Imp-11)promote the nuclear accumulation and activity of transcription factor NF-E2 (Nrf2) by restricting the transcription factor from partitioning to the mitochondria.
22404213 Knockdown of ubiquitin-conjugating enzyme E2E 3 (UBE2E3) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18614808 UBE2E3 is essential for the proliferation of RPE-1 cells and is downregulated during RPE layer maturation in the developing mouse eye.

AA Sequence

MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKEL      1 - 70
AEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINS     71 - 140
QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT       141 - 207
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25378586 2015 The ubiquitin-conjugating enzyme UBE2E3 and its import receptor importin-11 regulate the localization and activity of the antioxidant transcription factor NRF2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
More...