Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.15
PubTator Score 2.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.232 5.9e-05
breast carcinoma -1.300 1.7e-04
ductal carcinoma in situ -1.200 7.8e-03
fibroadenoma -1.200 2.8e-02
group 3 medulloblastoma -2.000 1.4e-03
invasive ductal carcinoma -2.100 4.9e-04
osteosarcoma -1.765 2.4e-03
ovarian cancer -1.400 5.4e-10
spina bifida -1.116 4.2e-02
subependymal giant cell astrocytoma 1.579 1.3e-02

Gene RIF (1)

AA Sequence

MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDE      1 - 70
DDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANV     71 - 140
VKDPPSKYVLYTLAVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPRKRLRRNFTAETIA    141 - 210
RRSRAFEQFLGHLQAVPELRHAPDLQDFFVLPELRRAQSLTCTGLYREALALWANAWQLQAQLGTPSGPD    211 - 280
RPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEARLQAL    281 - 350
QEAGLTPTPPPSLKELLIKEVLD                                                   351 - 373
//

Text Mined References (10)

PMID Year Title