Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
R01 Count 6
Funding $612,877
PubMed Score 35.35
PubTator Score 10.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.353 0.027
medulloblastoma, large-cell 1.200 0.007
pancreatic ductal adenocarcinoma liver m... -1.630 0.021
Pick disease -1.400 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q969S9 A0AR28 Q8N6D8 Q8WYI0 Q9H6Z1 RRF2mt
Symbols EFG2
RRF2
MRRF2
hEFG2
MST027
RRF2mt
EF-G2mt
MSTP027
mEF-G 2

Gene

Gene RIF (5)

PMID Text
26016410 GFM2 mutations could be causative of a phenotype of Leigh syndrome with arthrogryposis multiplex congenita.
22719265 These findings constitute the first reported phenotype associated with SNPs in the EF-G2mt gene and implicate the human EF-G2mt gene as a pharmacogenetic candidate gene for statin toxicity in humans
20877624 Observational study of gene-disease association. (HuGE Navigator)
19716793 EF-G2mt is an exclusive recycling factor in mammalian mitochondrial protein synthesis.
18753147 Myoblasts isolated from the MELAS patients show A3243G mutation in tRNALeu(UUR) produces a severe respiratory chain deficiency and this phenotype can be partially suppressed by overexpression of EFTu and EFG2.

AA Sequence

MLTNLRIFAMSHQTIPSVYINNICCYKIRASLKRLKPHVPLGRNCSSLPGLIGNDIKSLHSIINPPIAKI      1 - 70
RNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERGITIQSAAVTFDWKGYRVNLI     71 - 140
DTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHNIPRICFLNKMDKTGASFKYAVES    141 - 210
IREKLKAKPLLLQLPIGEAKTFKGVVDVVMKEKLLWNCNSNDGKDFERKPLLEMNDPELLKETTEARNAL    211 - 280
IEQVADLDDEFADLVLEEFSENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGIQPLLDAVTMYLP    281 - 350
SPEERNYEFLQWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLLLPFADQ    351 - 420
HVEIPSLTAGNIALTVGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLLAGVEIPEPVF    421 - 490
FCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPL    491 - 560
QVAYRETILNSVRATDTLDRTLGDKRHLVTVEVEARPIETSSVMPVIEFEYAESINEGLLKVSQEAIENG    561 - 630
IHSACLQGPLLGSPIQDVAITLHSLTIHPGTSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDY    631 - 700
LSPVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNT    701 - 770
LLNRRSGLT                                                                 771 - 779
//

Text Mined References (13)

PMID Year Title
26016410 2015 Compound heterozygous GFM2 mutations with Leigh syndrome complicated by arthrogryposis multiplex congenita.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22719265 2012 Polymorphisms in the mitochondrial ribosome recycling factor EF-G2mt/MEF2 compromise cell respiratory function and increase atorvastatin toxicity.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19716793 2009 EF-G2mt is an exclusive recycling factor in mammalian mitochondrial protein synthesis.
18753147 2008 The A3243G tRNALeu(UUR) MELAS mutation causes amino acid misincorporation and a combined respiratory chain assembly defect partially suppressed by overexpression of EFTu and EFG2.
16632485 2006 The molecular basis for tissue specificity of the oxidative phosphorylation deficiencies in patients with mutations in the mitochondrial translation factor EFG1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...