Property Summary

NCBI Gene PubMed Count 26
Grant Count 81
R01 Count 3
Funding $23,596,067
PubMed Score 40.70
PubTator Score 31.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.300 0.023

Synonym

Gene

PANTHER Protein Class (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651910 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC10

Gene RIF (17)

PMID Text
26240284 HDAC10 regulates cyclin A2 expression by deacetylating histones near the let-7 promoter.
26221039 study identifies an HDAC10-mediated regulatory mechanism controlling the DNA mismatch repair function of MSH2.
25337229 Suggest HDAC10 expression as a prognostic marker for gastric cancer.
24145760 this study is describing HDAC10 as a promoter of autophagy-mediated survival in neuroblastoma cells and identifying this HDAC isozyme as a druggable regulator of advanced-stage tumor cell survival.
23897811 HDAC10 suppresses expression of matrix metalloproteinase (MMP) 2 and 9 genes, which are known to be critical for cancer cell invasion and metastasis
23801752 results demonstrate that HDAC10 protects cancer cells from cytotoxic agents by mediating autophagy and identify this HDAC isozyme as a druggable regulator of advanced-stage tumor cell survival
21247901 Histone deacetylases 9 and 10 are required for homologous recombination.
20680488 HDAC10 is involved in transcriptional downregulation of TXNIP, leading to altered reactive oxygen species signaling in human gastric cancer cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20471694 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEELGLVHSPEYVS      1 - 70
LVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTGAVQNGLALVRPPGHHGQRAA     71 - 140
ANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQYLFEDDPSVLYFSWHRYEHGRFWPFLRESD    141 - 210
ADAVGRGQGLGFTVNLPWNQVGMGNADYVAAFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPE    211 - 280
CFAHLTQLLQVLAGGRVCAVLEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQ    281 - 350
APHWKSLQQQDVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD    351 - 420
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAAT    421 - 490
LDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVSTPLPVMTGGFLSCIL    491 - 560
GLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGLAGGRVLALLEENSTPQLAGILARVLNGEAP    561 - 630
PSLGPSSVASPEDVQALMYLRGQLEPQWKMLQCHPHLVA                                   631 - 669
//

Text Mined References (28)

PMID Year Title
26240284 2015 Histone Deacetylase 10 Regulates the Cell Cycle G2/M Phase Transition via a Novel Let-7-HMGA2-Cyclin A2 Pathway.
26221039 2015 Histone deacetylase 10 regulates DNA mismatch repair and may involve the deacetylation of MutS homolog 2.
25337229 2014 Decreased expression of histone deacetylase 10 predicts poor prognosis of gastric cancer patients.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145760 2013 Histone deacetylase 10-promoted autophagy as a druggable point of interference to improve the treatment response of advanced neuroblastomas.
23897811 2013 Histone deacetylase (HDAC) 10 suppresses cervical cancer metastasis through inhibition of matrix metalloproteinase (MMP) 2 and 9 expression.
23801752 2013 Histone deacetylase 10 promotes autophagy-mediated cell survival.
21247901 2011 Histone deacetylases 9 and 10 are required for homologous recombination.
20680488 2010 Inhibition of histone deacetylase 10 induces thioredoxin-interacting protein and causes accumulation of reactive oxygen species in SNU-620 human gastric cancer cells.
More...