Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.300 5.6e-03
ovarian cancer 1.800 2.6e-04
pancreatic cancer 1.300 4.9e-03
primary pancreatic ductal adenocarcinoma 1.326 1.3e-03

Gene RIF (1)

AA Sequence

MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLVPGLSWWNVFVPFFAADGLSTYFTTIVSVR      1 - 70
LFQDGEKRLAVLRLFWVLTVLSLKFVFEMLLCQKLAEQTRELWFGLITSPLFILLQLLMIRACRVN         71 - 136
//

Text Mined References (4)

PMID Year Title