Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.6144397381799E-4
primary pancreatic ductal adenocarcinoma 1271 0.00128680519504902
pancreatic cancer 2300 0.00494077403559704
acute myeloid leukemia 785 0.00600548052388381

Synonym

Accession Q969S6 Q6NW08
Symbols HBEBP1

Gene

  Ortholog (7)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
25996873 Tmem203 is an evolutionarily conserved regulator of cellular calcium homeostasis, is required for spermatogenesis and provides a causal link between intracellular calcium regulation and spermiogenesis.

AA Sequence

MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLVPGLSWWNVFVPFFAADGLSTYFTTIVSVR      1 - 70
LFQDGEKRLAVLRLFWVLTVLSLKFVFEMLLCQKLAEQTRELWFGLITSPLFILLQLLMIRACRVN         71 - 136
//

Text Mined References (4)

PMID Year Title
25996873 2015 TMEM203 Is a Novel Regulator of Intracellular Calcium Homeostasis and Is Required for Spermatogenesis.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.