Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $114,020.8
PubMed Score 2.83
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
astrocytic glioma 2,241
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma -1.300 0.035
osteosarcoma -1.074 0.000

Synonym

Accession Q969S3
Symbols ZPR9

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
21771788 ZPR9 was found to physically interact with ASK1 through a disulfide linkage;ZPR9 functions as a novel positive regulator of ASK1.
12645566 ZPR9 plays an important role in modulation of the transactivation by B-MYB and cellular growth of neuroblastoma cells

AA Sequence

MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCT      1 - 70
VCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQP     71 - 140
SMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDW    141 - 210
EDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIP    211 - 280
DIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFR    281 - 350
SSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVG    351 - 420
RVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRVQVRF                 421 - 477
//

Text Mined References (13)

PMID Year Title
27346687 2016 DNAJC21 Mutations Link a Cancer-Prone Bone Marrow Failure Syndrome to Corruption in 60S Ribosome Subunit Maturation.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21771788 2011 Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9 protein, a zinc finger protein.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...