Property Summary

NCBI Gene PubMed Count 46
PubMed Score 49.01
PubTator Score 38.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 1.036 2.4e-02
atypical teratoid / rhabdoid tumor -1.200 5.3e-06
osteosarcoma -3.613 6.1e-10

Gene RIF (28)

AA Sequence

MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPT      1 - 70
PEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGS     71 - 140
VWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEAL    141 - 210
GQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRP    211 - 280
QHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS                      281 - 332
//

Text Mined References (50)

PMID Year Title