Property Summary

NCBI Gene PubMed Count 39
Grant Count 36
R01 Count 17
Funding $1,962,753.49
PubMed Score 46.89
PubTator Score 38.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.613 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
active Crohn's disease 1.036 0.024

Gene RIF (26)

PMID Text
26751644 NEIL1 and NEIL2 cooperate with TDG during base excision: TDG occupies the abasic site and is displaced by NEILs, which further process the baseless sugar, thereby stimulating TDG-substrate turnover.
26601495 The variability of potentially important functional polymorphic variants of the IFNG, IFNGR2 and NEIL2 genes was characterized in representatives of four ethnic groups living in the Siberian region.
26554163 Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays.
26373042 variant alleles in the NEIL2 (rs804270), APE1 (rs2275008), CYP2E1 (rs2031920) and MDM2 (rs2279744) SNPs may independently influence susceptibility to gastric cancer in a Northern Jiangsu Chinese population.
24595271 data strongly suggest that decreased repair of oxidative DNA base lesions due to an impaired NEIL2 expression in non-smokers exposed to SSS would lead to accumulation of mutations in genomic DNA of lung cells over time
24406253 CSB protein stimulates NEIL2 DNA glycosylase activity
22497777 Results suggest that the decreased DNA repair capacity of the DNA glycosylase NEIL2 R257L variant can induce mutations that lead to lung cancer development.
22199273 REG4, BIRC5 and NEIL2 genes might have a role in the sensitivity of cancer patients to radiotherapy
22130663 the critical role of NEIL2 and PNKP in maintenance of the mammalian mitochondrial genome.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPT      1 - 70
PEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGS     71 - 140
VWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEAL    141 - 210
GQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRP    211 - 280
QHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS                      281 - 332
//

Text Mined References (43)

PMID Year Title
26751644 2016 Neil DNA glycosylases promote substrate turnover by Tdg during DNA demethylation.
26601495 2015 [Characteristic of the Genetic Variability of Four Polymorphic Variants (rs2069705, rs17880053, rs11126176, and rs804271) in Representative Samples of Indigenous and Alien Populations of Siberia].
26554163 2015 Genetic Variation of BCL2 (rs2279115), NEIL2 (rs804270), LTA (rs909253), PSCA (rs2294008) and PLCE1 (rs3765524, rs10509670) Genes and Their Correlation to Gastric Cancer Risk Based on Universal Tagged Arrays and Fe3O4 Magnetic Nanoparticles.
26373042 2015 Polymorphisms in NEIL-2, APE-1, CYP2E1 and MDM2 Genes are Independent Predictors of Gastric Cancer Risk in a Northern Jiangsu Population (China).
25416956 2014 A proteome-scale map of the human interactome network.
24595271 2014 NEIL2 protects against oxidative DNA damage induced by sidestream smoke in human cells.
24406253 2014 Cockayne Syndrome group B protein stimulates NEIL2 DNA glycosylase activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...