Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.60
PubTator Score 4.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 6.4e-05
Breast cancer 3.000 2.5e-02
ovarian cancer -1.500 5.4e-09
pancreatic ductal adenocarcinoma liver m... -1.202 1.5e-02

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMV      1 - 70
TMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAK     71 - 140
QVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIFQETLYKRFGKHSKEALFYNHALPLPGFVFL    141 - 210
ASDIYDHAVLFNKSELYEIPVIGVTLPIMWFYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVS    211 - 280
LIFSILYFQNPFTLWHWLGTLFVFIGTLMYTEVWNNLGTTKSEPQKDSKKN                       281 - 331
//

Text Mined References (14)

PMID Year Title