Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.60
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.276 0.014
Breast cancer 3.000 0.025
ovarian cancer 1.600 0.001

Synonym

Accession Q969S0 A4D1P3 A6NNS4 Q53GQ7 Q8TCU7 Q96K33
Symbols YEA
YEA4

Gene

Gene RIF (3)

PMID Text
21918738 subcellular localization of SLC35B4
21507882 Decreased SLC35B4 expression led to increased gluconeogenesis in HepG2 cells.
15911612 Transport capabilities for UDP-Glc and UDP-Xyl were determined with Golgi vesicles isolated from transformed cells

AA Sequence

MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMV      1 - 70
TMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAK     71 - 140
QVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIFQETLYKRFGKHSKEALFYNHALPLPGFVFL    141 - 210
ASDIYDHAVLFNKSELYEIPVIGVTLPIMWFYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVS    211 - 280
LIFSILYFQNPFTLWHWLGTLFVFIGTLMYTEVWNNLGTTKSEPQKDSKKN                       281 - 331
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21918738 2011 Subcellular localization of UDP-GlcNAc, UDP-Gal and SLC35B4 transporters.
21507882 2011 Deep congenic analysis identifies many strong, context-dependent QTLs, one of which, Slc35b4, regulates obesity and glucose homeostasis.
16965264 2006 Molecular and functional characterization of microsomal UDP-glucuronic acid uptake by members of the nucleotide sugar transporter (NST) family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15911612 2005 The human solute carrier gene SLC35B4 encodes a bifunctional nucleotide sugar transporter with specificity for UDP-xylose and UDP-N-acetylglucosamine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...