Property Summary

NCBI Gene PubMed Count 24
PubMed Score 222.20
PubTator Score 44.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 2.4e-03
Astrocytoma, Pilocytic -1.200 2.6e-04
atypical teratoid/rhabdoid tumor -1.100 5.0e-07
ependymoma -1.100 1.3e-08
glioblastoma -1.100 4.4e-09
mucosa-associated lymphoid tissue lympho... 1.296 4.0e-02
non primary Sjogren syndrome sicca 1.100 1.4e-02
osteosarcoma -3.103 8.7e-08
sonic hedgehog group medulloblastoma -1.400 3.4e-07
spina bifida -1.139 8.1e-03

Gene RIF (11)

AA Sequence

MGKAAAPSRGGGCGGRSRGLSSLFTVVPCLSCHTAAPGMSASTSGSGPEPKPQPQPVPEPERGPLSEQVS      1 - 70
EAVSEAVPRSEPVSETTSEPEPGAGQPSELLQGSRPGSESSSGVGAGPFTKAASEPLSRAVGSATFLRPE     71 - 140
SGSLPALKPLPLLRPGQAKTPLGVPMSGTGTTSSAPLALLPLDSFEGWLLKWTNYLKGYQRRWFVLGNGL    141 - 210
LSYYRNQGEMAHTCRGTINLSTAHIDTEDSCGILLTSGARSYHLKASSEVDRQQWITALELAKAKAVRVM    211 - 280
NTHSDDSGDDDEATTPADKSELHHTLKNLSLKLDDLSTCNDLIAKHGAALQRSLTELDGLKIPSESGEKL    281 - 350
KVVNERATLFRITSNAMINACRDFLELAEIHSRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSA    351 - 420
PGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITVITEAKEDSRKAEGSTGTSSVDWSSA    421 - 490
DNVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEY    491 - 560
HHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPS    561 - 630
AAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSG    631 - 700
DIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSD    701 - 770
GKQKTVYQTLSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTE    771 - 840
KQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWH    841 - 910
MCPNIF                                                                    911 - 916
//

Text Mined References (26)

PMID Year Title