Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.15
PubTator Score 12.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Multiple myeloma 1332 1.9e-04
ovarian cancer 8519 2.9e-04
pituitary cancer 1972 4.7e-04
group 3 medulloblastoma 4104 4.2e-03
Waldenstrons macroglobulinemia 765 5.1e-03
ependymoma 4679 9.5e-03
osteosarcoma 7950 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Enamel erosion 19 3.014 1.5
Tooth agenesis 44 3.004 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 9.5e-03
group 3 medulloblastoma 1.100 4.2e-03
Multiple myeloma 1.406 1.9e-04
osteosarcoma -1.087 1.1e-02
ovarian cancer -1.200 2.9e-04
pituitary cancer -1.100 4.7e-04
Waldenstrons macroglobulinemia 1.239 5.1e-03

Synonym

Accession Q969Q6 B4DEN7 D3DS97 D3DS98 Q5GJ55 Q5GJ56 Q6P4G2 Q86TZ3 Q9NWR9
Symbols G4-1
G5pr
C14orf10

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (2)

AA Sequence

MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVL      1 - 70
LQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENFLKVGEKAGAKCKQFFTA     71 - 140
KVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLYDVAGQGYLRESDLENYILELIPTLPQLDGL    141 - 210
EKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYG    211 - 280
QYLNLDKDHNGMLSKEELSRYGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIF    281 - 350
KLLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV    351 - 420
TTILIDLNGFWTYENREALVANDSENSADLDDT                                         421 - 453
//

Text Mined References (12)

PMID Year Title