Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.03
PubTator Score 12.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 9.83932963923056E-5
Multiple myeloma 1328 1.91859212984434E-4
pituitary cancer 1972 4.71694404995542E-4
group 3 medulloblastoma 2254 0.00416543782673074
Waldenstrons macroglobulinemia 765 0.00514709161630046
ependymoma 2514 0.00947549209105916
osteosarcoma 7933 0.0108232962117613
Disease Target Count Z-score Confidence
Alopecia 55 3.001 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.239 0.005
Multiple myeloma 1.406 0.000
ependymoma 1.200 0.009
osteosarcoma -1.087 0.011
group 3 medulloblastoma 1.100 0.004
ovarian cancer 1.900 0.000
pituitary cancer -1.100 0.000

Synonym

Accession Q969Q6 B4DEN7 D3DS97 D3DS98 Q5GJ55 Q5GJ56 Q6P4G2 Q86TZ3 Q9NWR9
Symbols G4-1
G5pr
C14orf10

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG
C. elegans OMA EggNOG

 GO Function (1)

Gene RIF (2)

PMID Text
24333728 Knockdown of PP5 and/or PPP2R3C increased P-gp expression and lowered the sensitivity to vincristine and doxorubicin. Consequently, results indicate that PP5/PPP2R3C negatively regulates P-gp expression and function.
22753944 G5PR expression is markedly augmented in the centrocytes of germinal centers after immunization of transgenic mice with T cell-dependent antigen.

AA Sequence

MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVL      1 - 70
LQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENFLKVGEKAGAKCKQFFTA     71 - 140
KVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLYDVAGQGYLRESDLENYILELIPTLPQLDGL    141 - 210
EKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYG    211 - 280
QYLNLDKDHNGMLSKEELSRYGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIF    281 - 350
KLLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV    351 - 420
TTILIDLNGFWTYENREALVANDSENSADLDDT                                         421 - 453
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24333728 2014 Protein phosphatase complex PP5/PPP2R3C dephosphorylates P-glycoprotein/ABCB1 and down-regulates the expression and function.
22753944 2012 Transgenic overexpression of G5PR that is normally augmented in centrocytes impairs the enrichment of high-affinity antigen-specific B cells, increases peritoneal B-1a cells, and induces autoimmunity in aged female mice.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16129705 2005 Protein phosphatase subunit G5PR is needed for inhibition of B cell receptor-induced apoptosis.
15820313 2005 Defining a holoprosencephaly locus on human chromosome 14q13 and characterization of potential candidate genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...