Property Summary

NCBI Gene PubMed Count 12
Grant Count 3
R01 Count 2
Funding $797,704.14
PubMed Score 12.03
PubTator Score 12.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.239 0.005
Multiple myeloma 1.406 0.000
ependymoma 1.200 0.009
osteosarcoma -1.087 0.011
group 3 medulloblastoma 1.100 0.004
ovarian cancer 1.900 0.000
pituitary cancer -1.100 0.000

Synonym

Accession Q969Q6 B4DEN7 D3DS97 D3DS98 Q5GJ55 Q5GJ56 Q6P4G2 Q86TZ3 Q9NWR9
Symbols G4-1
G5pr
C14orf10

Gene

PANTHER Protein Class (2)

 GO Function (1)

Gene RIF (2)

PMID Text
24333728 Knockdown of PP5 and/or PPP2R3C increased P-gp expression and lowered the sensitivity to vincristine and doxorubicin. Consequently, results indicate that PP5/PPP2R3C negatively regulates P-gp expression and function.
22753944 G5PR expression is markedly augmented in the centrocytes of germinal centers after immunization of transgenic mice with T cell-dependent antigen.

AA Sequence

MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVL      1 - 70
LQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENFLKVGEKAGAKCKQFFTA     71 - 140
KVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLYDVAGQGYLRESDLENYILELIPTLPQLDGL    141 - 210
EKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYG    211 - 280
QYLNLDKDHNGMLSKEELSRYGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIF    281 - 350
KLLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV    351 - 420
TTILIDLNGFWTYENREALVANDSENSADLDDT                                         421 - 453
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24333728 2014 Protein phosphatase complex PP5/PPP2R3C dephosphorylates P-glycoprotein/ABCB1 and down-regulates the expression and function.
22753944 2012 Transgenic overexpression of G5PR that is normally augmented in centrocytes impairs the enrichment of high-affinity antigen-specific B cells, increases peritoneal B-1a cells, and induces autoimmunity in aged female mice.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16129705 2005 Protein phosphatase subunit G5PR is needed for inhibition of B cell receptor-induced apoptosis.
15820313 2005 Defining a holoprosencephaly locus on human chromosome 14q13 and characterization of potential candidate genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...