Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.13
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (3)

AA Sequence

MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERY      1 - 70
EAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQ     71 - 140
DYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH           141 - 203
//

Text Mined References (14)

PMID Year Title