Property Summary

NCBI Gene PubMed Count 11
Grant Count 11
R01 Count 6
Funding $601,317.33
PubMed Score 16.52
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (2)

PMID Text
23387408 Rab24 modulates several mitotic events, including chromosome segregation and cytokinesis, perhaps through the interaction with microtubules
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERY      1 - 70
EAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQ     71 - 140
DYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH           141 - 203
//

Text Mined References (13)

PMID Year Title
23387408 2013 Rab24 is required for normal cell division.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16034420 2005 Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12323076 2002 Mutant Rab24 GTPase is targeted to nuclear inclusions.
More...