Property Summary

NCBI Gene PubMed Count 23
Grant Count 10
Funding $1,144,658.19
PubMed Score 23.14
PubTator Score 38.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.025
interstitial cystitis 1.300 0.006
axial spondyloarthropathy 1.100 0.034
psoriasis 1.500 0.000

Gene RIF (26)

PMID Text
23940804 A statistically significant (p = 0.0037) decrease of ARLTS1 expression in prostate cancer cases was detected.
22028916 the important role of ARLTS1 Cys148Arg variant as a contributor in prostate cancer predisposition
20358297 The role of the allelic variants in ARLTS1, RAD51 and MDM2 acting in the tumor suppressor, DNA repair and p53 pathways as risk factors for familial breast cancer in 147 patients displaying characteristics of familial disease, was investigated.
20358297 Observational study of gene-disease association. (HuGE Navigator)
20067102 A significantly increased risk was observed for young ovarian cancer patients with ARLTS1 Cys148Arg variant.
20067102 Observational study of gene-disease association. (HuGE Navigator)
19509554 Data show a significantly increased risk of familial OC for ARLTS1 Cys148Arg variant, which indicate that ARLTS1 may play a role in familial ovarian cancer.
19509554 Observational study of gene-disease association. (HuGE Navigator)
18375053 A novel tumor suppressor gene [ARLTS1 (ADP-ribosylation factor-like tumor suppressor gene 1)]is found to be altered in human carcinogenesis. It is located in Chromosome 13q14.3.
18337727 ARLTS1 germline variants are not associated with breast, prostate, and colorectal cancer
More...

AA Sequence

MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPL      1 - 70
RASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLS     71 - 140
LERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS                  141 - 196
//

Text Mined References (23)

PMID Year Title
23940804 2013 ARLTS1 and prostate cancer risk--analysis of expression and regulation.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
22028916 2011 Contribution of ARLTS1 Cys148Arg (T442C) variant with prostate cancer risk and ARLTS1 function in prostate cancer cells.
20358297 2011 ARLTS1, MDM2 and RAD51 gene variations are associated with familial breast cancer.
20067102 2009 [Polymorphism of ARLTS1 gene in early-onset ovarian cancer].
19509554 2009 Association of the ARLTS1 variants with familial ovarian cancer risk in China.
19060904 2009 An empirical framework for binary interactome mapping.
18375053 2008 ARLTS1 - a novel tumor suppressor gene.
18337727 2008 ARLTS1 germline variants and the risk for breast, prostate, and colorectal cancer.
17699778 2007 Tumor suppressor functions of ARLTS1 in lung cancers.
More...