Property Summary

NCBI Gene PubMed Count 24
PubMed Score 23.14
PubTator Score 38.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Ovarian Neoplasms 102 0.0 0.0
Disease Target Count
ovarian neoplasm 99
Disease Target Count P-value
psoriasis 6694 8.7e-128
interstitial cystitis 2312 6.3e-03
Rheumatoid arthritis 1191 2.5e-02
axial spondyloarthropathy 28 3.4e-02
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 2.2
Disease Target Count Z-score Confidence
Dysplastic nevus syndrome 7 3.224 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
axial spondyloarthropathy 1.100 3.4e-02
interstitial cystitis 1.300 6.3e-03
psoriasis 1.500 8.7e-128
Rheumatoid arthritis 1.500 2.5e-02

Synonym

Accession Q969Q4
Symbols ARLTS1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (27)

AA Sequence

MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPL      1 - 70
RASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLS     71 - 140
LERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS                  141 - 196
//

Text Mined References (24)

PMID Year Title