Property Summary

NCBI Gene PubMed Count 52
PubMed Score 189.72
PubTator Score 255.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Atrophic 10
Disease Target Count P-value
lung adenocarcinoma 2716 7.7e-11
diabetes mellitus 1728 2.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Kidney Failure 111 3.117 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 2.9e-03
lung adenocarcinoma -1.300 7.7e-11

Gene RIF (40)

AA Sequence

MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCANDIFQAANPYWTSRGSSVSMSG      1 - 70
GRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQECSSRPLQKGSHPMCKEHEDEKINIYCLTCEVP     71 - 140
TCSMCKVFGIHKACEVAPLQSVFQGQKTELNNCISMLVAGNDRVQTIITQLEDSRRVTKENSHQVKEELS    141 - 210
QKFDTLYAILDEKKSELLQRITQEQEKKLSFIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATFLLTAK    211 - 280
QLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEE    281 - 350
GHQ                                                                       351 - 353
//

Text Mined References (53)

PMID Year Title