Property Summary

NCBI Gene PubMed Count 49
Grant Count 95
R01 Count 69
Funding $10,123,308.92
PubMed Score 170.42
PubTator Score 255.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 0.003
lung adenocarcinoma -1.300 0.000

Synonym

Accession Q969Q1 B4DN95 Q5T2I1 Q96BD3 Q96KD9 Q9BYV4
Symbols IRF
SMRZ
MURF1
MURF2
RNF28

Gene

PANTHER Protein Class (2)

PDB

2D8U   3DDT   4M3L  

Gene RIF (37)

PMID Text
26919175 Altogether, these results suggest a novel function for p63 as a contributor to muscular atrophic processes via the regulation of multiple genes, including the muscle atrophy gene Trim63.
26137861 Skeletal muscle atrophy induced by Angiotensin II involves activation of MuRF1 expression.
26048142 Expression of USP19 correlates with that of MuRF1 and MAFbx/atrogin-1 in skeletal muscles
25950827 TRIM63 gene expression involved in skin hyperpigmentation.
25876656 Vitamin D3 might have an inhibitory effect on the expression of MAFbx and MuRF1 in skeletal muscle.
25801283 A novel protein aggregate myopathies and cardiomyopathy resulting from combined homozygous MuRF1 null mutation and heterozygous MuRF3 missense mutation.
25760630 MURF1 expression intended to be increased in the skeletal muscle of patients with malignant disease even before cancer related cachexia weight loss.
25096180 both MuRF1 and MAFbx are enriched in skeletal, cardiac, and smooth muscle--REVIEW
24920680 SMAD3 regulates transcription of MuRF-1 by increasing FoxO3 binding at a conserved FRE-SBE motif within the proximal promoter region, and by increasing FoxO3 protein content and transcriptional activity.
24865491 These data strongly supported that rare variants in MuRF1 and MuRF2 are associated with higher penetrance and more severe clinical manifestations of hypertrophic cardiomyopathy.
More...

AA Sequence

MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCANDIFQAANPYWTSRGSSVSMSG      1 - 70
GRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQECSSRPLQKGSHPMCKEHEDEKINIYCLTCEVP     71 - 140
TCSMCKVFGIHKACEVAPLQSVFQGQKTELNNCISMLVAGNDRVQTIITQLEDSRRVTKENSHQVKEELS    141 - 210
QKFDTLYAILDEKKSELLQRITQEQEKKLSFIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATFLLTAK    211 - 280
QLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEE    281 - 350
GHQ                                                                       351 - 353
//

Text Mined References (50)

PMID Year Title
26919175 2016 Transcriptional activator TAp63 is upregulated in muscular atrophy during ALS and induces the pro-atrophic ubiquitin ligase Trim63.
26137861 2015 Angiotensin II Induces Skeletal Muscle Atrophy by Activating TFEB-Mediated MuRF1 Expression.
26048142 2015 Inactivation of the ubiquitin-specific protease 19 deubiquitinating enzyme protects against muscle wasting.
25950827 2015 Identification of Genes Expressed in Hyperpigmented Skin Using Meta-Analysis of Microarray Data Sets.
25876656 2015 1?,25(OH)2D3 downregulates gene expression levels of muscle ubiquitin ligases MAFbx and MuRF1 in human myotubes.
25801283 2015 New cardiac and skeletal protein aggregate myopathy associated with combined MuRF1 and MuRF3 mutations.
25760630 2015 Muscle-specific E3 ubiquitin ligases are involved in muscle atrophy of cancer cachexia: an in vitro and in vivo study.
25096180 2014 Skeletal muscle atrophy and the E3 ubiquitin ligases MuRF1 and MAFbx/atrogin-1.
24920680 2014 SMAD3 augments FoxO3-induced MuRF-1 promoter activity in a DNA-binding-dependent manner.
24865491 2014 Rare variants in genes encoding MuRF1 and MuRF2 are modifiers of hypertrophic cardiomyopathy.
More...