Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.59
PubTator Score 3.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.02463950364084E-7
Pneumonia 133 7.14607929145241E-6
dermatomyositis 967 0.0025966870134734
Waldenstrons macroglobulinemia 765 0.00268678395417189
Disease Target Count Z-score Confidence
Pure red-cell aplasia 4 4.103 2.1
Diamond-Blackfan anemia 30 3.987 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.250 0.003
Pneumonia -1.500 0.000
ovarian cancer -2.200 0.000
dermatomyositis 1.100 0.003

Synonym

Accession Q969Q0 Q3B7A5
Symbols RPL36A

Gene

  Ortholog (4)

Species Source
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRL      1 - 70
ECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF                                       71 - 106
//

Text Mined References (12)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12490704 2002 Functional second genes generated by retrotransposition of the X-linked ribosomal protein genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8722009 Structure and evolution of mammalian ribosomal proteins.
3542712 1986 Characterisation of an mRNA encoding a human ribosomal protein homologous to the yeast L44 ribosomal protein.
More...