Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.59
PubTator Score 3.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.250 0.003
Pneumonia -1.500 0.000
ovarian cancer -2.200 0.000
dermatomyositis 1.100 0.003

Synonym

Accession Q969Q0 Q3B7A5
Symbols RPL36A

Gene

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRL      1 - 70
ECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF                                       71 - 106
//

Text Mined References (12)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12490704 2002 Functional second genes generated by retrotransposition of the X-linked ribosomal protein genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8722009 Structure and evolution of mammalian ribosomal proteins.
3542712 1986 Characterisation of an mRNA encoding a human ribosomal protein homologous to the yeast L44 ribosomal protein.
More...