Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.20
PubTator Score 9.51

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.96976607303644E-12
chronic lymphosyte leukemia 232 1.05746555575749E-5
osteosarcoma 7933 0.00195086874219277
medulloblastoma, large-cell 6234 0.00196285892574355
ovarian cancer 8492 0.0027782663599889
group 4 medulloblastoma 1875 0.00910002552496496


  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.506 0.002
chronic lymphosyte leukemia 1.100 0.000
medulloblastoma, large-cell 1.600 0.002
non-small cell lung cancer 1.020 0.000
group 4 medulloblastoma -1.300 0.009
ovarian cancer 1.100 0.003


Accession Q969P6 B7ZAR5 E7ES89 Q86ST4 Q86V82 TOP1mt


  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (5)

24172750 Data indicate that the different coordination geometry achieved by the two transition metal ions has an important role in modulating their efficiency as topoisomerase I inhibitors.
23422507 Data reported in this paper indicate that hTop IB does not confer to the cells radio-resistance, but the kinetic analysis of both DNA repair rate as well as colonies growth, demonstrates that the cells containing hTop IB show a more efficient rescue from IR injury.
23261817 DNA topoisomerase I stimulates BLM helicase activity on a nucleolar-relevant RNA:DNA hybrid.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

DPRISIAWCKRFRVPVEKIYSKTQRERFAWALAMAGEDFEF                                 561 - 601

Text Mined References (19)

PMID Year Title
24172750 2014 Effect of oxindolimine copper(II) and zinc(II) complexes on human topoisomerase I activity.
23422507 2013 Role of human topoisomerase IB on ionizing radiation induced damage.
23261817 Collaborating functions of BLM and DNA topoisomerase I in regulating human rDNA transcription.
21531700 2011 Coordinated regulation of mitochondrial topoisomerase IB with mitochondrial nuclear encoded genes and MYC.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19720733 2009 Adaptation of topoisomerase I paralogs to nuclear and mitochondrial DNA.
18826252 2008 Mitochondrial topoisomerase I sites in the regulatory D-loop region of mitochondrial DNA.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.