Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 11.24
PubTator Score 9.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
chronic lymphosyte leukemia 1.100 1.1e-05
group 4 medulloblastoma -1.300 9.1e-03
medulloblastoma, large-cell 1.300 6.0e-05
non-small cell lung cancer 1.020 4.0e-12
osteosarcoma -1.506 2.0e-03
ovarian cancer 1.100 2.8e-03

Gene RIF (5)

AA Sequence

MRVVRLLRLRAALTLLGEVPRRPASRGVPGSRRTQKGSGARWEKEKHEDGVKWRQLEHKGPYFAPPYEPL      1 - 70
PDGVRFFYEGRPVRLSVAAEEVATFYGRMLDHEYTTKEVFRKNFFNDWRKEMAVEEREVIKSLDKCDFTE     71 - 140
IHRYFVDKAAARKVLSREEKQKLKEEAEKLQQEFGYCILDGHQEKIGNFKIEPPGLFRGRGDHPKMGMLK    141 - 210
RRITPEDVVINCSRDSKIPEPPAGHQWKEVRSDNTVTWLAAWTESVQNSIKYIMLNPCSKLKGETAWQKF    211 - 280
ETARRLRGFVDEIRSQYRADWKSREMKTRQRAVALYFIDKLALRAGNEKEDGEAADTVGCCSLRVEHVQL    281 - 350
HPEADGCQHVVEFDFLGKDCIRYYNRVPVEKPVYKNLQLFMENKDPRDDLFDRLTTTSLNKHLQELMDGL    351 - 420
TAKVFRTYNASITLQEQLRALTRAEDSIAAKILSYNRANRVVAILCNHQRATPSTFEKSMQNLQTKIQAK    421 - 490
KEQVAEARAELRRARAEHKAQGDGKSRSVLEKKRRLLEKLQEQLAQLSVQATDKEENKQVALGTSKLNYL    491 - 560
DPRISIAWCKRFRVPVEKIYSKTQRERFAWALAMAGEDFEF                                 561 - 601
//

Text Mined References (19)

PMID Year Title