Property Summary

NCBI Gene PubMed Count 43
Grant Count 110
R01 Count 70
Funding $7,950,198.55
PubMed Score 291.02
PubTator Score 120.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q969P5 A4KYM0
Symbols Fbx32
MAFbx

Gene

Gene RIF (37)

PMID Text
26768247 Our data suggest that FBXO32 is a candidate gene for recessive familial dilated cardiomyopathy. Acting as a cardiac ubiquitin ligase, mutated FBXO32 could perturb the degradation of target proteins in the ubiquitin proteasome system.
26753747 Our results indicate that abnormal SCF activity with subsequent impairment of the autophagic flux due to a novel FBXO32 mutation is implicated in the pathogenesis of Dilated cardiomyopathy .
26048142 Expression of USP19 correlates with that of MuRF1 and MAFbx/atrogin-1 in skeletal muscles
25944903 FBXO32 targets Lys-326 of c-Myc to form polyubiquitin chains, resulting in inhibition of cell proliferation.
25876656 Vitamin D3 might have an inhibitory effect on the expression of MAFbx and MuRF1 in skeletal muscle.
25760630 Atrogin-1 expression tended to be increased in the skeletal muscle of patients with malignant disease even before cancer related cachexia weight loss.
25096180 both MuRF1 and MAFbx are enriched in skeletal, cardiac, and smooth muscle--REVIEW
24798237 FBXO32 methylation status and protein expression were independently associated with survival in ESCC. FBXO32 may be a functional tumor suppressor. Its inactivation through promoter methylation could play an important role in ESCC carcinogenesis.
24650875 MAFbx not only regulates protein degradation, but also reduces protein synthesis, exerting a dual role in regulating cardiac mass and preventing from cardiac hypertrophy.
24458747 In conclusion, atrogin-1, MuRF1, FOXO1/3A, and eIF3-f mRNA, and protein levels, are differentially regulated by exercise contraction mode but not WPH supplementation combined with hypertrophy-inducing training.
More...

AA Sequence

MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLN      1 - 70
SKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGI     71 - 140
AQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQL    141 - 210
NNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIR    211 - 280
KRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFI    281 - 350
NLFKF                                                                     351 - 355
//

Text Mined References (45)

PMID Year Title
26768247 2016 A substitution mutation in cardiac ubiquitin ligase, FBXO32, is associated with an autosomal recessive form of dilated cardiomyopathy.
26753747 2016 FBXO32, encoding a member of the SCF complex, is mutated in dilated cardiomyopathy.
26048142 2015 Inactivation of the ubiquitin-specific protease 19 deubiquitinating enzyme protects against muscle wasting.
25944903 2015 FBXO32 Targets c-Myc for Proteasomal Degradation and Inhibits c-Myc Activity.
25876656 2015 1?,25(OH)2D3 downregulates gene expression levels of muscle ubiquitin ligases MAFbx and MuRF1 in human myotubes.
25760630 2015 Muscle-specific E3 ubiquitin ligases are involved in muscle atrophy of cancer cachexia: an in vitro and in vivo study.
25096180 2014 Skeletal muscle atrophy and the E3 ubiquitin ligases MuRF1 and MAFbx/atrogin-1.
24798237 2014 Aberrant methylation and decreased expression of the TGF-?/Smad target gene FBXO32 in esophageal squamous cell carcinoma.
24650875 2014 MAFbx/Atrogin-1 is required for atrophic remodeling of the unloaded heart.
24458747 2014 Influence of divergent exercise contraction mode and whey protein supplementation on atrogin-1, MuRF1, and FOXO1/3A in human skeletal muscle.
More...