Property Summary

NCBI Gene PubMed Count 43
PubMed Score 291.02
PubTator Score 120.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Muscular atrophy 67
Disease Target Count P-value
non-small cell lung cancer 2798 5.32382295040043E-31
psoriasis 6685 1.62729464188625E-10
Breast cancer 3099 2.90093095324141E-10
lung adenocarcinoma 2714 6.29098921729094E-9
glioblastoma multiforme 347 6.64870300121411E-9
pituitary cancer 1972 1.64269514012329E-6
atypical teratoid / rhabdoid tumor 4369 6.30573275818324E-6
Duchenne muscular dystrophy 602 1.05880967413274E-5
Pick disease 1893 2.89617051028545E-5
ovarian cancer 8492 1.69252092037315E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.90939769603611E-4
breast carcinoma 1614 7.92116953441713E-4
group 4 medulloblastoma 1875 8.43229123068425E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00159940699039994
subependymal giant cell astrocytoma 2287 0.00215537622537734
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00255553706372472
primary pancreatic ductal adenocarcinoma 1271 0.00440837622224818
acute quadriplegic myopathy 1157 0.00590710810130426
medulloblastoma, large-cell 6234 0.00646491895251261
ulcerative colitis 2087 0.00687998005317008
pancreatic cancer 2300 0.00844309962738496
invasive ductal carcinoma 2950 0.00940956076867638
cystic fibrosis 1670 0.0137642768998223
non diabetic and post-ischemic heart failure 200 0.0150284943687054
Alzheimer's disease 644 0.0183921148662465
gastric carcinoma 832 0.0254786556000644
osteosarcoma 7933 0.0255990837325581
oligodendroglioma 2849 0.0394414050686425
astrocytic glioma 2241 0.0426700141525775
primitive neuroectodermal tumor 3031 0.0428745737918288
spina bifida 1064 0.0430853957424171

Expression

Synonym

Accession Q969P5 A4KYM0
Symbols Fbx32
MAFbx

Gene

  Ortholog (10)

 MGI Term (1)

Gene RIF (37)

PMID Text
26768247 Our data suggest that FBXO32 is a candidate gene for recessive familial dilated cardiomyopathy. Acting as a cardiac ubiquitin ligase, mutated FBXO32 could perturb the degradation of target proteins in the ubiquitin proteasome system.
26753747 Our results indicate that abnormal SCF activity with subsequent impairment of the autophagic flux due to a novel FBXO32 mutation is implicated in the pathogenesis of Dilated cardiomyopathy .
26048142 Expression of USP19 correlates with that of MuRF1 and MAFbx/atrogin-1 in skeletal muscles
25944903 FBXO32 targets Lys-326 of c-Myc to form polyubiquitin chains, resulting in inhibition of cell proliferation.
25876656 Vitamin D3 might have an inhibitory effect on the expression of MAFbx and MuRF1 in skeletal muscle.
25760630 Atrogin-1 expression tended to be increased in the skeletal muscle of patients with malignant disease even before cancer related cachexia weight loss.
25096180 both MuRF1 and MAFbx are enriched in skeletal, cardiac, and smooth muscle--REVIEW
24798237 FBXO32 methylation status and protein expression were independently associated with survival in ESCC. FBXO32 may be a functional tumor suppressor. Its inactivation through promoter methylation could play an important role in ESCC carcinogenesis.
24650875 MAFbx not only regulates protein degradation, but also reduces protein synthesis, exerting a dual role in regulating cardiac mass and preventing from cardiac hypertrophy.
24458747 In conclusion, atrogin-1, MuRF1, FOXO1/3A, and eIF3-f mRNA, and protein levels, are differentially regulated by exercise contraction mode but not WPH supplementation combined with hypertrophy-inducing training.
More...

AA Sequence

MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLN      1 - 70
SKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGI     71 - 140
AQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQL    141 - 210
NNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIR    211 - 280
KRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFI    281 - 350
NLFKF                                                                     351 - 355
//

Text Mined References (45)

PMID Year Title
26768247 2016 A substitution mutation in cardiac ubiquitin ligase, FBXO32, is associated with an autosomal recessive form of dilated cardiomyopathy.
26753747 2016 FBXO32, encoding a member of the SCF complex, is mutated in dilated cardiomyopathy.
26048142 2015 Inactivation of the ubiquitin-specific protease 19 deubiquitinating enzyme protects against muscle wasting.
25944903 2015 FBXO32 Targets c-Myc for Proteasomal Degradation and Inhibits c-Myc Activity.
25876656 2015 1?,25(OH)2D3 downregulates gene expression levels of muscle ubiquitin ligases MAFbx and MuRF1 in human myotubes.
25760630 2015 Muscle-specific E3 ubiquitin ligases are involved in muscle atrophy of cancer cachexia: an in vitro and in vivo study.
25096180 2014 Skeletal muscle atrophy and the E3 ubiquitin ligases MuRF1 and MAFbx/atrogin-1.
24798237 2014 Aberrant methylation and decreased expression of the TGF-?/Smad target gene FBXO32 in esophageal squamous cell carcinoma.
24650875 2014 MAFbx/Atrogin-1 is required for atrophic remodeling of the unloaded heart.
24458747 2014 Influence of divergent exercise contraction mode and whey protein supplementation on atrogin-1, MuRF1, and FOXO1/3A in human skeletal muscle.
More...