Property Summary

NCBI Gene PubMed Count 50
PubMed Score 329.81
PubTator Score 120.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Muscular atrophy 71 6.895 3.4
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (31)

Disease log2 FC p
acute quadriplegic myopathy 1.111 5.9e-03
Alzheimer's disease 1.100 1.8e-02
astrocytic glioma 1.500 4.3e-02
atypical teratoid / rhabdoid tumor -2.400 6.3e-06
autosomal dominant Emery-Dreifuss muscul... -1.128 2.6e-03
Breast cancer -2.100 2.9e-10
breast carcinoma -1.400 7.9e-04
cystic fibrosis 1.300 1.4e-02
Duchenne muscular dystrophy -1.108 3.7e-06
gastric carcinoma 1.700 4.0e-02
glioblastoma multiforme 1.200 6.6e-09
group 3 medulloblastoma -1.100 4.9e-02
intraductal papillary-mucinous adenoma (... 2.800 1.6e-03
intraductal papillary-mucinous carcinoma... 1.600 2.0e-02
invasive ductal carcinoma 1.095 1.2e-03
lung adenocarcinoma 1.500 6.3e-09
medulloblastoma, large-cell -2.600 6.5e-03
non diabetic and post-ischemic heart fai... 1.300 1.5e-02
non-small cell lung cancer 2.065 7.8e-19
oligodendroglioma -1.400 3.9e-02
osteosarcoma 1.344 2.6e-02
ovarian cancer -1.600 3.8e-04
pancreatic cancer 1.100 5.0e-03
Pick disease 1.300 2.7e-05
pituitary cancer -2.400 1.4e-04
primary pancreatic ductal adenocarcinoma 2.212 1.0e-02
primitive neuroectodermal tumor -1.500 4.3e-02
psoriasis -1.600 1.6e-10
spina bifida -2.011 4.4e-02
subependymal giant cell astrocytoma 3.655 2.9e-03
ulcerative colitis -1.200 8.7e-04

 MGI Phenotype (1)

Gene RIF (43)

AA Sequence

MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLN      1 - 70
SKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGI     71 - 140
AQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQL    141 - 210
NNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIR    211 - 280
KRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFI    281 - 350
NLFKF                                                                     351 - 355
//

Text Mined References (52)

PMID Year Title