Property Summary

NCBI Gene PubMed Count 25
Grant Count 21
R01 Count 21
Funding $988,698.54
PubMed Score 22.26
PubTator Score 23.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -1.200 0.000
oligodendroglioma -1.100 0.000
posterior fossa group B ependymoma -2.000 0.000
group 3 medulloblastoma -1.900 0.000
atypical teratoid/rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.400 0.003
adult high grade glioma -1.300 0.000
subependymal giant cell astrocytoma -1.842 0.016
Pick disease -1.300 0.000
pituitary cancer 1.500 0.000

Gene RIF (12)

PMID Text
25656846 EWI-2 negatively regulates TGF-beta signaling and its downstream events including cytostasis (in vitro and in vivo), EMT-like changes, cell migration, CD271-dependent invasion, and lung metastasis (in vivo).
23351194 Authors demonstrated that EWI-2wint promotes CD81 clustering and confinement in CD81-enriched areas.
22689882 The EWI-2/alpha-actinin complex is involved in regulation of the actin cytoskeleton at T cell immune and virological synapses, providing a link between membrane microdomains and the formation of polarized membrane structures involved in T cell recognition.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21343309 analysis of interacting regions of CD81 and two of its partners, EWI-2 and EWI-2wint, and their effect on hepatitis C virus infection
19107234 EWI-2 causes a substantial molecular reorganization of multiple molecules known to affect proliferation and/or invasion of astrocytes and/or glioblastomas.
18382656 CD81 partner EWI-2wint inhibits hepatitis C virus entry [EWI-2wint]
17785435 Important functions of recently activated dendritic cells are thus critically modulated by the newly discovered HSPA8-EWI-2 interaction.
16690612 EWI-2 and EWI-F link the tetraspanin web to the actin cytoskeleton through their direct association with ezrin-radixin-moesin proteins
16537545 EWI proteins EWI-2 and EWI-F, alpha3beta1 and alpha6beta4 integrins, and protein palmitoylation have contrasting effects on cell surface CD9 organization
More...

AA Sequence

MGALRPTLLPPSLPLLLLLMLGMGCWAREVLVPEGPLYRVAGTAVSISCNVTGYEGPAQQNFEWFLYRPE      1 - 70
APDTALGIVSTKDTQFSYAVFKSRVVAGEVQVQRLQGDAVVLKIARLQAQDAGIYECHTPSTDTRYLGSY     71 - 140
SGKVELRVLPDVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELALGCLARTSTQKHTHLAVSFGRSVPEAP    141 - 210
VGRSTLQEVVGIRSDLAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPD    211 - 280
GSWAQIAEKRAVLAHVDVQTLSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPA    281 - 350
GAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLR    351 - 420
EAASARSRPLPVHVREEGVVLEAVAWLAGGTVYRGETASLLCNISVRGGPPGLRLAASWWVERPEDGELS    421 - 490
SVPAQLVGGVGQDGVAELGVRPGGGPVSVELVGPRSHRLRLHSLGPEDEGVYHCAPSAWVQHADYSWYQA    491 - 560
GSARSGPVTVYPYMHALDTLFVPLLVGTGVALVTGATVLGTITCCFMKRLRKR                     561 - 613
//

Text Mined References (28)

PMID Year Title
25656846 2015 EWI-2 negatively regulates TGF-? signaling leading to altered melanoma growth and metastasis.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23351194 2013 EWI-2wint promotes CD81 clustering that abrogates Hepatitis C Virus entry.
22689882 2012 EWI-2 association with ?-actinin regulates T cell immune synapses and HIV viral infection.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21343309 2011 Interacting regions of CD81 and two of its partners, EWI-2 and EWI-2wint, and their effect on hepatitis C virus infection.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
More...