Property Summary

NCBI Gene PubMed Count 25
PubMed Score 23.21
PubTator Score 23.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 4.3e-04
Astrocytoma, Pilocytic -1.100 8.7e-04
atypical teratoid / rhabdoid tumor -1.200 4.3e-04
ependymoma -1.700 2.1e-11
glioblastoma -1.200 5.9e-06
group 3 medulloblastoma -1.900 7.0e-05
medulloblastoma, large-cell -1.400 3.0e-03
oligodendroglioma -1.100 1.2e-13
Pick disease -1.300 3.7e-04
pituitary cancer 1.500 3.5e-06
subependymal giant cell astrocytoma -1.842 1.6e-02

Protein-protein Interaction (11)

Gene RIF (13)

AA Sequence

MGALRPTLLPPSLPLLLLLMLGMGCWAREVLVPEGPLYRVAGTAVSISCNVTGYEGPAQQNFEWFLYRPE      1 - 70
APDTALGIVSTKDTQFSYAVFKSRVVAGEVQVQRLQGDAVVLKIARLQAQDAGIYECHTPSTDTRYLGSY     71 - 140
SGKVELRVLPDVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELALGCLARTSTQKHTHLAVSFGRSVPEAP    141 - 210
VGRSTLQEVVGIRSDLAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPD    211 - 280
GSWAQIAEKRAVLAHVDVQTLSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPA    281 - 350
GAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLR    351 - 420
EAASARSRPLPVHVREEGVVLEAVAWLAGGTVYRGETASLLCNISVRGGPPGLRLAASWWVERPEDGELS    421 - 490
SVPAQLVGGVGQDGVAELGVRPGGGPVSVELVGPRSHRLRLHSLGPEDEGVYHCAPSAWVQHADYSWYQA    491 - 560
GSARSGPVTVYPYMHALDTLFVPLLVGTGVALVTGATVLGTITCCFMKRLRKR                     561 - 613
//

Text Mined References (28)

PMID Year Title