Property Summary

NCBI Gene PubMed Count 10
Grant Count 2
Funding $167,116.25
PubMed Score 37.93
PubTator Score 10.30

Knowledge Summary

Patent (3,048)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Synonym

Accession Q969N4 Q5VUQ0 TaR-8
Symbols TA5
TAR5
TRAR5
TaR-5
TaR-8
GPR102

Gene

PANTHER Protein Class (2)

 Grant Application (2)

  TechDev Info (1)

Gene RIF (2)

PMID Text
25391046 For the first time is confirmed basal Gi/o signaling activity for TAAR8.
16878137 Previous studies reported TAAR expression in brain. This paper found TAAR expression only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines.

AA Sequence

MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFKQLHSPTNFLI      1 - 70
ASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVLHLCFICIDRYIVVTDPLVYA     71 - 140
TKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELVSALNCVGGCQIIVSQGWVLIDFLLFFIPTL    141 - 210
VMIILYSKIFLIAKQQAIKIETTSSKVESSSESYKIRVAKRERKAAKTLGVTVLAFVISWLPYTVDILID    211 - 280
AFMGFLTPAYIYEICCWSAYYNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE            281 - 342
//

Text Mined References (11)

PMID Year Title
25391046 2014 Analysis of human TAAR8 and murine Taar8b mediated signaling pathways and expression profile.
21885028 2011 Mutations causing familial biparental hydatidiform mole implicate c6orf221 as a possible regulator of genomic imprinting in the human oocyte.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16878137 2006 A second class of chemosensory receptors in the olfactory epithelium.
16584120 2006 Receptors of mammalian trace amines.
15718104 2005 Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11574155 2001 Discovery and mapping of ten novel G protein-coupled receptor genes.
More...