Property Summary

NCBI Gene PubMed Count 10
PubMed Score 39.43
PubTator Score 10.30

Knowledge Summary

Patent (3,048)

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 3.1e-03

Gene RIF (2)

AA Sequence

MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFKQLHSPTNFLI      1 - 70
ASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVLHLCFICIDRYIVVTDPLVYA     71 - 140
TKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELVSALNCVGGCQIIVSQGWVLIDFLLFFIPTL    141 - 210
VMIILYSKIFLIAKQQAIKIETTSSKVESSSESYKIRVAKRERKAAKTLGVTVLAFVISWLPYTVDILID    211 - 280
AFMGFLTPAYIYEICCWSAYYNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE            281 - 342
//

Text Mined References (11)

PMID Year Title