Property Summary

NCBI Gene PubMed Count 20
Grant Count 7
R01 Count 4
Funding $1,113,372.45
PubMed Score 66.67
PubTator Score 10.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
23733340 Germline mutation and a somatic mutation in PIGT is associated with paroxysmal nocturnal hemoglobinuria.
23636107 mutations in PIGT as the cause of a novel autosomal recessive intellectual disability syndrome
15713669 ER-localized because of information in its transmembrane span
12582175 GPI8 and PIG-T form a functionally important intermolecular disulfide bridge

AA Sequence

MAAAMPLALLVLLLLGPGGWCLAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQREGVSHYRLFP      1 - 70
KALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTVTDVDKSWKELSNVLSGIFCA     71 - 140
SLNFIDSTNTVTPTASFKPLGLANDTDHYFLRYAVLPREVVCTENLTPWKKLLPCSSKAGLSVLLKADRL    141 - 210
FHTSYHSQAVHIRPVCRNARCTSISWELRQTLSVVFDAFITGQGKKDWSLFRMFSRTLTEPCPLASESRV    211 - 280
YVDITTYNQDNETLEVHPPPTTTYQDVILGTRKTYAIYDLLDTAMINNSRNLNIQLKWKRPPENEAPPVP    281 - 350
FLHAQRYVSGYGLQKGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ    351 - 420
DRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKPVDWEESP    421 - 490
LFNSLFPVSDGSNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCYGSFYNLLTRTFHIEEPRTGG    491 - 560
LAKRLANLIRRARGVPPL                                                        561 - 578
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23733340 2013 A case of paroxysmal nocturnal hemoglobinuria caused by a germline mutation and a somatic mutation in PIGT.
23636107 2013 A novel intellectual disability syndrome caused by GPI anchor deficiency due to homozygous mutations in PIGT.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16516892 2006 The novel neurotrophin-regulated neuronal development-associated protein, NDAP, mediates apoptosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...