Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.54
PubTator Score 2.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 8.5e-40
ovarian cancer 8520 1.5e-04
osteosarcoma 7950 6.5e-03
astrocytic glioma 2597 4.8e-02

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.200 4.8e-02
osteosarcoma -1.489 6.5e-03
ovarian cancer 2.200 1.5e-04
psoriasis 1.300 8.5e-40

Gene RIF (2)

AA Sequence

MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT      1 - 70
PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV     71 - 140
WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR                             141 - 185
//

Text Mined References (8)

PMID Year Title