Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.45
PubTator Score 2.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 8.54581232449317E-40
osteosarcoma 7933 2.08374537054142E-6
ovarian cancer 8492 1.54795526097E-4
astrocytic glioma 2241 0.0477013350074796

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.200 0.048
osteosarcoma -1.713 0.000
psoriasis 1.300 0.000
ovarian cancer 2.200 0.000

Synonym

Gene

PDB

4GBA   2EDI   3FN1  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23300442 The conjugation of NEDD8 to Cullin-5 by UBE2F is required for HIV-1 Vif-mediated A3G degradation
23201271 Distinct preferences of UBC12 and UBE2F peptides for inhibiting different DCNLs, including the oncogenic DCNL1.

AA Sequence

MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT      1 - 70
PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV     71 - 140
WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR                             141 - 185
//

Text Mined References (8)

PMID Year Title
23201271 2013 Structural conservation of distinctive N-terminal acetylation-dependent interactions across a family of mammalian NEDD8 ligation enzymes.
19250909 2009 E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.