Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.80
PubTator Score 1.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.009
ependymoma -1.800 0.016
oligodendroglioma -1.100 0.041
osteosarcoma -1.994 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.100 0.003
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.300 0.001
tuberculosis 1.100 0.002
intraductal papillary-mucinous neoplasm ... 1.200 0.001
lung adenocarcinoma 1.100 0.000

Synonym

Accession Q969M1 B7Z4U0 D3DVG9
Symbols TOMM40B

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTIHMSA      1 - 70
LGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGE     71 - 140
YRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGGELVYHRRPGEEGAILTLAGKYSAVHWVATL    141 - 210
NVGSGGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMP    211 - 280
PLPVTLALGAFLNHWRNRFHCGFSITVG                                              281 - 308
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24816252 2014 An atlas of genetic influences on human blood metabolites.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...