Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.80
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 5.82827700551255E-13
osteosarcoma 7933 7.73697060970054E-5
medulloblastoma 1524 8.66976538452474E-5
atypical teratoid / rhabdoid tumor 4369 2.3333026074936E-4
medulloblastoma, large-cell 6234 5.24531802310783E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00130742478429164
tuberculosis 1563 0.00211711309097675
glioblastoma 5572 0.00317802651809226
astrocytic glioma 2241 0.00942439456178342
ependymoma 2514 0.0161879972906939
oligodendroglioma 2849 0.0410806731781369

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.009
ependymoma -1.800 0.016
oligodendroglioma -1.100 0.041
osteosarcoma -1.994 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.100 0.003
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.300 0.001
tuberculosis 1.100 0.002
intraductal papillary-mucinous neoplasm ... 1.200 0.001
lung adenocarcinoma 1.100 0.000

Synonym

Accession Q969M1 B7Z4U0 D3DVG9
Symbols TOMM40B

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTIHMSA      1 - 70
LGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGE     71 - 140
YRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGGELVYHRRPGEEGAILTLAGKYSAVHWVATL    141 - 210
NVGSGGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMP    211 - 280
PLPVTLALGAFLNHWRNRFHCGFSITVG                                              281 - 308
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24816252 2014 An atlas of genetic influences on human blood metabolites.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...