Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.80
PubTator Score 1.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 9.4e-03
atypical teratoid / rhabdoid tumor -1.400 2.3e-04
ependymoma -1.800 1.6e-02
glioblastoma -1.100 3.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.3e-03
lung adenocarcinoma 1.100 5.8e-13
medulloblastoma -1.200 8.7e-05
medulloblastoma, large-cell -1.300 5.2e-04
oligodendroglioma -1.100 4.1e-02
osteosarcoma -1.994 7.7e-05
tuberculosis 1.100 2.1e-03

Gene RIF (1)

AA Sequence

MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTIHMSA      1 - 70
LGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGE     71 - 140
YRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGGELVYHRRPGEEGAILTLAGKYSAVHWVATL    141 - 210
NVGSGGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMP    211 - 280
PLPVTLALGAFLNHWRNRFHCGFSITVG                                              281 - 308
//

Text Mined References (15)

PMID Year Title