Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.32
PubTator Score 4.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Accession Q969L4
Symbols MST074
MSTP074

Gene

Gene RIF (4)

PMID Text
19277982 The subnuclear organization of histone gene regulatory proteins and 3' end processing factors (NPAT/LSM10) of normal somatic and embryonic stem cells is compromised in selected human cancer cell types.
16914750 The overexpression of Lsm10 and Lsm11 increases the cellular levels of U7 snRNP but has no effect on histone pre-mRNA processing.
16087681 Lsm10 and Lsm11, which replace the Sm proteins D1 and D2 in the histone RNA processing U7 snRNPs, associate with pICln in vitro and in vivo without receiving sDMA modifications and with PRMT5 and SMN complexes
11574479 Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein.

AA Sequence

MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLD      1 - 70
DLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK                      71 - 123
//

Text Mined References (13)

PMID Year Title
19277982 2009 The subnuclear organization of histone gene regulatory proteins and 3' end processing factors of normal somatic and embryonic stem cells is compromised in selected human cancer cell types.
19060904 2009 An empirical framework for binary interactome mapping.
18082603 2007 Purification of human telomerase complexes identifies factors involved in telomerase biogenesis and telomere length regulation.
16914750 2006 ZFP100, a component of the active U7 snRNP limiting for histone pre-mRNA processing, is required for entry into S phase.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16087681 2005 Toward an assembly line for U7 snRNPs: interactions of U7-specific Lsm proteins with PRMT5 and SMN complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
12975319 2003 Unique Sm core structure of U7 snRNPs: assembly by a specialized SMN complex and the role of a new component, Lsm11, in histone RNA processing.
More...