Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.41
PubTator Score 4.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 1.9e-02
ovarian cancer 1.100 1.6e-03
pancreatic ductal adenocarcinoma liver m... -1.184 6.6e-03

Synonym

Accession Q969L4
Symbols MST074
MSTP074

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLD      1 - 70
DLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK                      71 - 123
//

Text Mined References (14)

PMID Year Title