Property Summary

NCBI Gene PubMed Count 28
PubMed Score 0.00
PubTator Score 27.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -5.000 4.1e-05
astrocytic glioma -4.300 1.2e-03
Astrocytoma, Pilocytic -5.700 6.2e-10
atypical teratoid / rhabdoid tumor -4.500 1.1e-04
Breast cancer 1.200 2.8e-04
breast carcinoma 1.300 7.3e-03
ductal carcinoma in situ 1.600 3.2e-02
ependymoma -3.100 1.1e-05
glioblastoma -4.700 2.7e-09
interstitial cystitis -3.400 2.2e-03
intraductal papillary-mucinous adenoma (... 2.100 5.3e-03
intraductal papillary-mucinous carcinoma... 2.100 8.3e-03
intraductal papillary-mucinous neoplasm ... 2.700 1.3e-02
invasive ductal carcinoma 2.100 2.7e-03
medulloblastoma -2.700 3.6e-03
medulloblastoma, large-cell -5.500 3.0e-06
non diabetic and post-ischemic heart fai... -1.300 2.8e-02
oligodendroglioma -3.200 1.4e-02
ovarian cancer 3.800 3.1e-04
pancreatic cancer 1.900 5.2e-07
Pick disease -2.200 2.0e-02
primitive neuroectodermal tumor -3.800 1.1e-04
spina bifida -2.412 3.9e-02
subependymal giant cell astrocytoma -4.776 1.3e-03

Gene RIF (10)

AA Sequence

MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMF      1 - 70
VSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPL     71 - 140
LSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP                                      141 - 176
//

Text Mined References (29)

PMID Year Title