Property Summary

NCBI Gene PubMed Count 6
PubMed Score 219.08
PubTator Score 97.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.1e-05
glioblastoma 1.700 8.9e-06
interstitial cystitis -1.500 1.3e-04
intraductal papillary-mucinous carcinoma... 1.200 3.1e-03
invasive ductal carcinoma 1.300 6.6e-04
lung adenocarcinoma 1.300 7.5e-07
non-small cell lung cancer 1.032 4.3e-12
pancreatic cancer 1.200 9.7e-03
pediatric high grade glioma 1.400 5.0e-06
primary pancreatic ductal adenocarcinoma 1.343 9.2e-03
psoriasis 1.200 1.7e-33
spina bifida -1.489 3.9e-02

AA Sequence

MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVVNILSVTSAIV      1 - 70
VITSGIAAIVLSRYLPSTPLRWTVFSSSVACALLSLTCALGLLASIAMTFATQGKALLAACTFGSSELLA     71 - 140
LAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQLTHQLLELRPWWGKSSHHMMRENPELVEGRD    141 - 210
LLSCTSSEPLTL                                                              211 - 222
//

Text Mined References (6)

PMID Year Title