Property Summary

NCBI Gene PubMed Count 6
PubMed Score 207.07
PubTator Score 97.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.93529718349734E-13
non-small cell lung cancer 2798 4.30669941497843E-12
lung adenocarcinoma 2714 7.4735322848616E-7
pediatric high grade glioma 2712 5.0247714307532E-6
glioblastoma 5572 8.85856823170133E-6
pilocytic astrocytoma 3086 2.26720282917926E-5
interstitial cystitis 2299 1.26714586509303E-4
invasive ductal carcinoma 2950 6.64391812195929E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00305937260806216
primary pancreatic ductal adenocarcinoma 1271 0.00917466184509693
pancreatic cancer 2300 0.00972884212163705
spina bifida 1064 0.0387130450924992

Expression

  Differential Expression (12)

Synonym

Accession Q969K7 Q6UV18 Q8IVD0 Q9UM12
Symbols BCLP
CAC1
CAC-1

Gene

  Ortholog (8)

AA Sequence

MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVVNILSVTSAIV      1 - 70
VITSGIAAIVLSRYLPSTPLRWTVFSSSVACALLSLTCALGLLASIAMTFATQGKALLAACTFGSSELLA     71 - 140
LAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQLTHQLLELRPWWGKSSHHMMRENPELVEGRD    141 - 210
LLSCTSSEPLTL                                                              211 - 222
//

Text Mined References (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11724320 Specific detection of circulating tumor cells by reverse transcriptase-polymerase chain reaction of a beta-casein-like protein, preferentially expressed in malignant neoplasms.
11394883 2001 Cloning and characterization of a tumor-associated antigen, beta-casein-like protein.
9500206 1998 Cloning and characterization of a cDNA fragment coding beta-casein-like protein preferentially expressed in cervical adenocarcinoma cell line CAC-1.