Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.33
PubTator Score 4.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 4.1e-04
atypical teratoid / rhabdoid tumor -1.100 4.1e-05
glioblastoma -1.100 1.8e-08
group 4 medulloblastoma -1.100 5.8e-04
medulloblastoma, large-cell -1.600 2.4e-04
osteosarcoma 1.078 6.9e-04
ovarian cancer -1.100 5.5e-06
posterior fossa group A ependymoma -1.100 4.5e-10
primitive neuroectodermal tumor -1.200 2.8e-03
Rheumatoid arthritis -1.500 3.9e-02
subependymal giant cell astrocytoma -1.511 8.5e-03

Gene RIF (3)

AA Sequence

MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGARCEANTFDGE      1 - 70
RCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFVVHGKPFRVHRCVLGARSAYF     71 - 140
ANMLDTKWKGKSVVVLRHPLINPVAFGALLQYLYTGRLDIGVEHVSDCERLAKQCQLWDLLSDLEAKCEK    141 - 210
VSEFVASKPGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVAG    211 - 280
CSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAY    281 - 350
DVLSVADMYLLPGLKRLCGRSLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMAKVIEKLVEREDFVEA    351 - 420
VKEEAAAVAARQETDSIPLVDDIRFHVASTVQTYSAIEEAQQRLRALEDLLVSIGLDC                421 - 478
//

Text Mined References (14)

PMID Year Title