Property Summary

NCBI Gene PubMed Count 23
PubMed Score 21.11
PubTator Score 13.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.5e-13
non primary Sjogren syndrome sicca 891 1.9e-02
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 1.9e-02
psoriasis 1.100 1.5e-13

Gene RIF (12)

AA Sequence

MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSC      1 - 70
SMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASA     71 - 140
GSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINN    141 - 210
SLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP                     211 - 263
//

Text Mined References (24)

PMID Year Title