Property Summary

NCBI Gene PubMed Count 19
PubMed Score 17.29
PubTator Score 13.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.54168525629871E-13
non primary Sjogren syndrome sicca 840 0.0192904247260918
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0

Synonym

Accession Q969J5 Q08AH7 Q6UWM1 Q96A41 Q96QR0 IL-22 receptor subunit alpha-2
Symbols CRF2X
CRF2-10
CRF2-S1
IL-22BP
IL-22RA2
ZCYTOR16
IL-22R-alpha-2

Gene

PDB

3G9V  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (8)

PMID Text
21041731 Through a combined approach including genetic and immunological investigation in an animal model and large-scale association studies of patients with multiple sclerosis (MS), IL-22RA2 is established as an MS risk gene.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19926456 Observational study of gene-disease association. (HuGE Navigator)
19393422 Polymorphisms in IL22RA1 are associated with severe CRS.
19285080 Comparison of IL-22/IL-22BP and IL-22/IL-22R1 crystal structures shows that both receptors display an overlapping IL-22 binding surface, which is consistent with the inhibitory role played by IL-22 binding protein.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19193995 Crystallization and preliminary X-ray diffraction results of the IL-22-IL-22 binding protein (IL-22BP) complex are described.
18675824 The IL-22R and IL-10R2 binding sites are juxtaposed on adjacent IL-22 surfaces contributed mostly by helices A, D, and F and loop AB.

AA Sequence

MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSC      1 - 70
SMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASA     71 - 140
GSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINN    141 - 210
SLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP                     211 - 263
//

Text Mined References (20)

PMID Year Title
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21041731 2010 IL-22RA2 associates with multiple sclerosis and macrophage effector mechanisms in experimental neuroinflammation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19926456 2010 Further association analysis of chr 6q22-24 suggests a role of IL-20RA polymorphisms in psoriasis.
19393422 2009 Polymorphisms in the interleukin-22 receptor alpha-1 gene are associated with severe chronic rhinosinusitis.
19285080 2009 Crystal structure of a soluble decoy receptor IL-22BP bound to interleukin-22.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19193995 2009 Crystallization and preliminary X-ray diffraction analysis of human IL-22 bound to its soluble decoy receptor IL-22BP.
18675824 2008 IL-22R, IL-10R2, and IL-22BP binding sites are topologically juxtaposed on adjacent and overlapping surfaces of IL-22.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...