Property Summary

NCBI Gene PubMed Count 19
Grant Count 5
R01 Count 3
Funding $270,487.93
PubMed Score 17.29
PubTator Score 13.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q969J5 Q08AH7 Q6UWM1 Q96A41 Q96QR0 IL-22 receptor subunit alpha-2
Symbols CRF2X
CRF2-10
CRF2-S1
IL-22BP
IL-22RA2
ZCYTOR16
IL-22R-alpha-2

Gene

PDB

3G9V  

Gene RIF (8)

PMID Text
21041731 Through a combined approach including genetic and immunological investigation in an animal model and large-scale association studies of patients with multiple sclerosis (MS), IL-22RA2 is established as an MS risk gene.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19926456 Observational study of gene-disease association. (HuGE Navigator)
19393422 Polymorphisms in IL22RA1 are associated with severe CRS.
19285080 Comparison of IL-22/IL-22BP and IL-22/IL-22R1 crystal structures shows that both receptors display an overlapping IL-22 binding surface, which is consistent with the inhibitory role played by IL-22 binding protein.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19193995 Crystallization and preliminary X-ray diffraction results of the IL-22-IL-22 binding protein (IL-22BP) complex are described.
18675824 The IL-22R and IL-10R2 binding sites are juxtaposed on adjacent IL-22 surfaces contributed mostly by helices A, D, and F and loop AB.

AA Sequence

MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSC      1 - 70
SMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASA     71 - 140
GSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINN    141 - 210
SLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP                     211 - 263
//

Text Mined References (20)

PMID Year Title
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21041731 2010 IL-22RA2 associates with multiple sclerosis and macrophage effector mechanisms in experimental neuroinflammation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19926456 2010 Further association analysis of chr 6q22-24 suggests a role of IL-20RA polymorphisms in psoriasis.
19393422 2009 Polymorphisms in the interleukin-22 receptor alpha-1 gene are associated with severe chronic rhinosinusitis.
19285080 2009 Crystal structure of a soluble decoy receptor IL-22BP bound to interleukin-22.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19193995 2009 Crystallization and preliminary X-ray diffraction analysis of human IL-22 bound to its soluble decoy receptor IL-22BP.
18675824 2008 IL-22R, IL-10R2, and IL-22BP binding sites are topologically juxtaposed on adjacent and overlapping surfaces of IL-22.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...