Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.30
PubTator Score 0.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 9.4e-08
astrocytic glioma 2597 6.5e-03
oligodendroglioma 2850 1.3e-02
ependymoma 4679 1.6e-02
Disease Target Count Z-score Confidence
Childhood acute lymphocytic leukemia 5 3.449 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.300 6.5e-03
ependymoma -1.200 1.6e-02
oligodendroglioma -1.100 1.3e-02
tuberculosis -1.800 9.4e-08

AA Sequence

MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLL      1 - 70
SGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYA     71 - 140
KYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL                  141 - 196
//

Text Mined References (19)

PMID Year Title