Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.05
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 0.0
Disease Target Count P-value
group 4 medulloblastoma 1855 3.5e-06
lung cancer 4740 2.9e-05
hepatocellular carcinoma 547 3.2e-04
tuberculosis 2010 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.200 3.5e-06
hepatocellular carcinoma 1.200 3.2e-04
lung cancer 1.800 2.9e-05
tuberculosis -1.100 2.0e-03

Gene RIF (3)

AA Sequence

MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPERSRQRFRGFRYPEAAGPREA      1 - 70
LSRLRELCGQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAP     71 - 140
QVPVGDQGQELLCCKMALLTQTQGSQSSQCQPMKALFKHESLGSQPLHDRVLQVPGLAQGGCCREDAMVA    141 - 210
SRLTPGSQGLLKMEDVALTLTPGWTQLDSSQVNLYRDEKQENHSSLVSLGGEIQTKSRDLPPVKKLPEKE    211 - 280
HGKICHLREDIAQIPTHAEAGEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYEC    281 - 350
EDCGKTFIGSSALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLL    351 - 420
EHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKNVQNPEHGESWESQGRTESQWENTEAPVSYKCN    421 - 490
ECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ                   491 - 545
//

Text Mined References (16)

PMID Year Title