Property Summary

NCBI Gene PubMed Count 16
PubMed Score 48.61
PubTator Score 23.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -2.505 6.4e-04
active ulcerative colitis -3.937 1.2e-04
Breast cancer -1.200 4.7e-02
colon cancer -2.700 7.7e-03
intraductal papillary-mucinous adenoma (... -1.700 4.6e-02
lung carcinoma 1.500 6.4e-08
pancreatic ductal adenocarcinoma liver m... -2.795 2.5e-03
psoriasis -1.200 5.4e-03

Gene RIF (6)

AA Sequence

MDPMELRNVNIEPDDESSSGESAPDSYIGIGNSEKAAMSSQFANEDTESQKFLTNGFLGKKKLADYADEH      1 - 70
HPGTTSFGMSSFNLSNAIMGSGILGLSYAMANTGIILFIIMLLAVAILSLYSVHLLLKTAKEGGSLIYEK     71 - 140
LGEKAFGWPGKIGAFVSITMQNIGAMSSYLFIIKYELPEVIRAFMGLEENTGEWYLNGNYLIIFVSVGII    141 - 210
LPLSLLKNLGYLGYTSGFSLTCMVFFVSVVIYKKFQIPCPLPVLDHSVGNLSFNNTLPMHVVMLPNNSES    211 - 280
SDVNFMMDYTHRNPAGLDENQAKGSLHDSGVEYEAHSDDKCEPKYFVFNSRTAYAIPILVFAFVCHPEVL    281 - 350
PIYSELKDRSRRKMQTVSNISITGMLVMYLLAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVL    351 - 420
VAVTLTVPIVLFPIRTSVITLLFPKRPFSWIRHFLIAAVLIALNNVLVILVPTIKYIFGFIGASSATMLI    421 - 490
FILPAVFYLKLVKKETFRSPQKVGALIFLVVGIFFMIGSMALIIIDWIYDPPNSKHH                 491 - 547
//

Text Mined References (16)

PMID Year Title