Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
Funding $631,608
PubMed Score 13.33
PubTator Score 12.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.403 0.001
glioblastoma 1.300 0.001
tuberculosis 1.400 0.000
lung cancer 1.600 0.003
group 3 medulloblastoma 1.200 0.001
ovarian cancer 1.800 0.000

Synonym

Accession Q969H6 A6NL80 Q53FS5 Q9Y2Q6 hPop5
Symbols RPP2
RPP20
hPop5
HSPC004

Gene

Gene RIF (3)

PMID Text
25704799 archaeal homologs of the human RNase P proteins Pop5 and Rpp30
22082156 Knockdown of processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae; POP5) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
18164267 Molecular mechanism by which Cartilage-hair hypolasia-associated mutations affect the function of RNase MRP.

AA Sequence

MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCR      1 - 70
KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQK     71 - 140
SVTRSCLLEEEEESGEEAAEAME                                                   141 - 163
//

Text Mined References (20)

PMID Year Title
25704799 2015 On archaeal homologs of the human RNase P proteins Pop5 and Rpp30 in the hyperthermophilic archaeon Thermococcus kodakarensis.
25416956 2014 A proteome-scale map of the human interactome network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18164267 2008 Cartilage-hair hypoplasia-associated mutations in the RNase MRP P3 domain affect RNA folding and ribonucleoprotein assembly.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...