Property Summary

NCBI Gene PubMed Count 26
Grant Count 7
R01 Count 5
Funding $280,229.56
PubMed Score 13.13
PubTator Score 22.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis -1.200 0.000
osteosarcoma -1.260 0.000
spina bifida -1.279 0.024
invasive ductal carcinoma 1.100 0.019

Gene RIF (12)

PMID Text
26319181 tyrosine phosphorylation is an important mechanism to control the subcellular localization of CNK1 and its distinct biological functions.
24825906 CNK1 mediates ephrinB1 signaling that promotes cell migration through RhoA and JNK activity.
21320536 Studies indicate that CNK1-driven proliferation relies on Akt-dependent phosphorylation and inactivation of FoxO proteins.
20634316 These findings identify CNK1 as a new positive regulator of insulin signaling.
20383191 CNK1 promotes oncogenic signalling through Akt in breast cancer cell lines and tumours.
20197385 Thus, CNK1 is an essential mediator of an oncogenic pathway involved in invasion of breast and cervical cancer cells and is therefore a putative target for cancer therapy.
19718030 DC-SIGN was constitutively associated with a signalosome complex consisting of the scaffold proteins LSP1, KSR1 and CNK and the kinase Raf-1.
16289034 CNK1 binds through the sterile alpha motif (SAM) and the conserved region in CNK (CRIC) to the AT2 receptor. CNK1 may play a role in the AT2 receptor-mediated signaling pathways.
15845549 CNK1 allows cross-talk between Src and Raf-1 and is essential for the full activation of Raf-1
15753034 CNK1 couples a subset of Rho exchange factors to activation of the JNK MAP kinase pathway and that signaling specificity is achieved through complexes containing both upstream activators and downstream targets of Rho.
More...

AA Sequence

MEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQAL      1 - 70
SSRLQTENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLHEADALLFWLSRYLFSHLNDF     71 - 140
SACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQKAVLEQVQLDSPLGL    141 - 210
EIHTTSNCQHFVSQVDTQVPTDSRLQIQPGDEVVQINEQVVVREERDMVGWPRKNMVRELLREPAGLSLV    211 - 280
LKKIPIPETPPQTPPQVLDSPHQRSPSLSLAPLSPRAPSEDVFAFDLSSNPSPGPSPAWTDSASLGPEPL    281 - 350
PIPPEPPAILPAGVAGTPGLPESPDKSPVGRKKSKGLATRLSRRRVSCRELGRPDCDGWLLLRKAPGGFM    351 - 420
GPRWRRRWFVLKGHTLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKPFIFAADTLTDL    421 - 490
SMWVRHLITCISKYQSPGRAPPPREEDCYSETEAEDPDDEAGSHSASPSPAQAGSPLHGDTSPAATPTQR    491 - 560
SPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQEQWRSSFMRRNRDPQLNERVHRVRALQSTL    561 - 630
KAKLQELQVLEEVLGDPELTGEKFRQWKEQNRELYSEGLGAWGVAQAEGSSHILTSDSTEQSPHSLPSDP    631 - 700
EEHSHLCPLTSESSLRPPDL                                                      701 - 720
//

Text Mined References (30)

PMID Year Title
26319181 2015 Differential tyrosine phosphorylation controls the function of CNK1 as a molecular switch in signal transduction.
25416956 2014 A proteome-scale map of the human interactome network.
24825906 2014 EphrinB1 interacts with CNK1 and promotes cell migration through c-Jun N-terminal kinase (JNK) activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21320536 2011 CNK1 and other scaffolds for Akt/FoxO signaling.
20634316 2010 The CNK1 scaffold binds cytohesins and promotes insulin pathway signaling.
20383191 2010 CNK1 is a novel Akt interaction partner that promotes cell proliferation through the Akt-FoxO signalling axis.
20197385 2010 CNK1 promotes invasion of cancer cells through NF-kappaB-dependent signaling.
19718030 2009 Carbohydrate-specific signaling through the DC-SIGN signalosome tailors immunity to Mycobacterium tuberculosis, HIV-1 and Helicobacter pylori.
More...