Property Summary

NCBI Gene PubMed Count 210
Grant Count 291
R01 Count 188
Funding $37,178,814.31
PubMed Score 527.88
PubTator Score 272.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.002
Multiple myeloma 1.270 0.018
astrocytic glioma -3.000 0.004
ependymoma -2.800 0.002
oligodendroglioma -2.300 0.000
cutaneous lupus erythematosus -1.100 0.001
glioblastoma -3.100 0.000
osteosarcoma -1.599 0.000
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -1.800 0.001
tuberculosis and treatment for 6 months 2.000 0.000
interstitial cystitis 1.100 0.000
adult high grade glioma -2.700 0.000
pilocytic astrocytoma -2.700 0.000
subependymal giant cell astrocytoma -1.685 0.044
lung carcinoma 2.400 0.000
Breast cancer -1.400 0.000
ulcerative colitis 1.200 0.000
ovarian cancer -1.800 0.000
pituitary cancer 1.300 0.001
Down syndrome -1.100 0.004

Synonym

Accession Q969H0 B7ZLP9 Q68DR0 Q96A16 Q96LE0 Q96RI2 Q9NUX6
Symbols AGO
CDC4
FBW6
FBW7
hAgo
FBX30
FBXW6
SEL10
hCdc4
FBXO30
SEL-10

Gene

PDB

5IBK   2OVP   2OVQ   2OVR  

Gene RIF (181)

PMID Text
26774344 When endogenous Fbw7 was knocked down, both NS5B protein abundance and HCV replication were remarkably up-regulated.
26774286 FBXW7 facilitates nonhomologous end-joining via K63-linked polyubiquitylation of XRCC4 in tumor cells.
26482194 Our observations sustain the role of FBXW7 as cancer predisposition gene and expand the spectrum of its possible associated diseases.
26464659 miR-25 is up-regulated in non-small cell lung cancer and promotes NSCLC cells proliferation and motility partially by targeting FBXW7.
26458995 Fbxw7 induces apoptosis and growth arrest and inhibits theepithelial-to-mesenchymal transition (EMT) in part by down-regulating the RhoA signaling pathway.
26354767 cells lacking FBW7 are sensitive to knockdown of the spindle assembly checkpoint (SAC) protein BUBR1
26341754 Mutant FBXW7 is an independent prognostic indicator for inferior survival in pediatric T-Acute lymphoblastic leukemia.
26323375 Results show that the expression of miR-92a is up-regulated in hepatocellular carcinoma (HCC) tissues and cell lines and confirm it as an independent prognostic marker. MiR-92a functions as a novel oncomiRNA by promoting tumor growth of HCC by targeting.
26306035 findings reveal FBW7 and GSK3 as novel regulators of the NFE2L3 transcription factor and a potential mechanism by which FBW7 might regulate detoxification and the cellular response to stress
26269414 we observed an association of FBW7 with p105 and p65, as well as p100, and knockdown of FBW7 eliminated 1,25D-dependent subunit turnover
More...

AA Sequence

MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQN      1 - 70
DSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHT     71 - 140
NSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFG    141 - 210
DLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDF    211 - 280
ISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSP    281 - 350
WKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH    351 - 420
TGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIET    421 - 490
GQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD    491 - 560
TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCL    561 - 630
QFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVL    631 - 700
DFDVDMK                                                                   701 - 707
//

Text Mined References (214)

PMID Year Title
26774344 2016 Ubiquitin ligase Fbw7 restricts the replication of hepatitis C virus by targeting NS5B for ubiquitination and degradation.
26774286 2016 FBXW7 Facilitates Nonhomologous End-Joining via K63-Linked Polyubiquitylation of XRCC4.
26482194 2015 Constitutional de novo deletion of the FBXW7 gene in a patient with focal segmental glomerulosclerosis and multiple primitive tumors.
26464659 2015 MiR-25 is up-regulated in non-small cell lung cancer and promotes cell proliferation and motility by targeting FBXW7.
26458995 2016 Fbxw7 regulates tumor apoptosis, growth arrest and the epithelial-to-mesenchymal transition in part through the RhoA signaling pathway in gastric cancer.
26354767 2015 Dependence of Human Colorectal Cells Lacking the FBW7 Tumor Suppressor on the Spindle Assembly Checkpoint.
26341754 2015 Genetic mutational profiling analysis of T cell acute lymphoblastic leukemia reveal mutant FBXW7 as a prognostic indicator for inferior survival.
26323375 2015 MicroRNA-92a contributes to tumor growth of human hepatocellular carcinoma by targeting FBXW7.
26306035 2015 Stringent Control of NFE2L3 (Nuclear Factor, Erythroid 2-Like 3; NRF3) Protein Degradation by FBW7 (F-box/WD Repeat-containing Protein 7) and Glycogen Synthase Kinase 3 (GSK3).
26269414 2015 The hormone-bound vitamin D receptor enhances the FBW7-dependent turnover of NF-?B subunits.
More...