Property Summary

NCBI Gene PubMed Count 261
PubMed Score 576.38
PubTator Score 272.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cancer 2499 5.125 2.6
Neuronal ceroid lipofuscinosis 2 17 3.036 1.5

Expression

  Differential Expression (23)

Disease log2 FC p
Breast cancer -1.100 2.5e-17
ovarian cancer -1.100 1.3e-04
adult high grade glioma -2.600 5.2e-06
astrocytic glioma -2.400 6.3e-03
Astrocytoma, Pilocytic -2.700 3.1e-09
atypical teratoid / rhabdoid tumor -2.200 6.2e-05
cutaneous lupus erythematosus -1.100 1.5e-03
Down syndrome -1.100 3.7e-03
ependymoma -2.400 5.2e-03
glioblastoma -2.300 3.7e-11
group 3 medulloblastoma -2.200 4.2e-04
interstitial cystitis 1.100 1.9e-04
lung carcinoma 2.400 2.5e-41
medulloblastoma, large-cell -3.400 2.6e-06
Multiple myeloma 1.270 1.8e-02
oligodendroglioma -1.700 3.6e-02
osteosarcoma -1.220 6.1e-04
pituitary cancer 1.200 1.2e-04
primitive neuroectodermal tumor -1.700 1.6e-03
Rheumatoid arthritis 1.100 2.4e-03
subependymal giant cell astrocytoma -1.685 4.4e-02
tuberculosis 1.600 2.5e-03
ulcerative colitis 1.200 2.8e-04

Protein-protein Interaction (7)

Gene RIF (224)

AA Sequence

MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQN      1 - 70
DSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHT     71 - 140
NSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFG    141 - 210
DLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDF    211 - 280
ISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSP    281 - 350
WKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH    351 - 420
TGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIET    421 - 490
GQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD    491 - 560
TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCL    561 - 630
QFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVL    631 - 700
DFDVDMK                                                                   701 - 707
//

Text Mined References (266)

PMID Year Title