Property Summary

NCBI Gene PubMed Count 12
Grant Count 13
R01 Count 10
Funding $1,343,629.83
PubMed Score 35.80
PubTator Score 10.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.783 0.000
posterior fossa group B ependymoma 1.200 0.000
lung carcinoma -1.100 0.000

Gene RIF (3)

PMID Text
26097589 Suggest that NKD1 plays an important role in invasion in human breast cancer and it appears to be a potential prognostic marker for patients with breast cancer.
21599923 Reduced NKD1 protein expression correlates with a poor prognosis in NSCLC
19956716 Mutations in the human naked cuticle homolog NKD1 found in colorectal cancer alter Wnt/Dvl/beta-catenin signaling

AA Sequence

MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIGRSTRELVGDV      1 - 70
LRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLKFEELQCDVSMEEDSRQEWTF     71 - 140
TLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKMLRVKLTVAPDGSQSKRSVLVNQADLQSARP    141 - 210
RAETKPTEDLRSWEKKQRAPLRFQGDSRLEQSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVA    211 - 280
QKSELPPRTSNPTRSRSHEPEAIHIPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPK    281 - 350
AQGKSVGVGHVARGARNKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPL    351 - 420
ASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQT                        421 - 470
//

Text Mined References (14)

PMID Year Title
26097589 2015 NKD1 down-regulation is associated with poor prognosis in breast invasive ductal carcinoma.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21599923 2011 Down-regulation of NKD1 increases the invasive potential of non-small-cell lung cancer and correlates with a poor prognosis.
19956716 2009 Mutations in the human naked cuticle homolog NKD1 found in colorectal cancer alter Wnt/Dvl/beta-catenin signaling.
16567647 2006 PR130 is a modulator of the Wnt-signaling cascade that counters repression of the antagonist Naked cuticle.
15687260 2005 PR72, a novel regulator of Wnt signaling required for Naked cuticle function.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...