Property Summary

NCBI Gene PubMed Count 16
PubMed Score 38.52
PubTator Score 10.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
lung carcinoma 2843 2.2e-14
posterior fossa group B ependymoma 416 7.3e-05
osteosarcoma 7950 1.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Chronic NK-cell lymphocytosis 6 3.651 1.8
Disease Target Count
Common variable immunodeficiency 101

Expression

  Differential Expression (3)

Disease log2 FC p
lung carcinoma -1.100 2.2e-14
osteosarcoma 1.063 1.2e-04
posterior fossa group B ependymoma 1.200 7.3e-05

Gene RIF (7)

AA Sequence

MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIGRSTRELVGDV      1 - 70
LRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLKFEELQCDVSMEEDSRQEWTF     71 - 140
TLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKMLRVKLTVAPDGSQSKRSVLVNQADLQSARP    141 - 210
RAETKPTEDLRSWEKKQRAPLRFQGDSRLEQSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVA    211 - 280
QKSELPPRTSNPTRSRSHEPEAIHIPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPK    281 - 350
AQGKSVGVGHVARGARNKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPL    351 - 420
ASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQT                        421 - 470
//

Text Mined References (18)

PMID Year Title