Property Summary

NCBI Gene PubMed Count 13
PubMed Score 55.59
PubTator Score 17.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.100 7.9e-04
astrocytic glioma -1.500 1.3e-02
glioblastoma -1.100 4.5e-04
intraductal papillary-mucinous adenoma (... 1.200 1.5e-02
lung cancer 1.300 1.7e-03
lung carcinoma 1.100 1.3e-21
medulloblastoma -1.400 5.5e-05
medulloblastoma, large-cell -1.700 2.1e-04
Multiple myeloma 1.002 1.9e-02
oligodendroglioma -1.100 4.8e-02
ovarian cancer -1.100 2.4e-02
psoriasis 1.700 2.3e-03
severe Alzheimer's disease -1.496 3.7e-02

Gene RIF (5)

AA Sequence

MRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPY      1 - 70
YKNTKKSMETHIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEHLKIKE     71 - 140
DNFFQVSKSKIMNGH                                                           141 - 155
//

Text Mined References (15)

PMID Year Title