Property Summary

NCBI Gene PubMed Count 13
Grant Count 26
Funding $5,144,918
PubMed Score 49.54
PubTator Score 17.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.002 0.019
astrocytoma -1.700 0.009
oligodendroglioma -1.100 0.048
psoriasis 1.700 0.002
glioblastoma -1.100 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.700 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.015
lung cancer 2.200 0.001
adult high grade glioma -1.100 0.001
severe Alzheimer's disease -1.496 0.037
lung carcinoma 1.100 0.000
ovarian cancer -1.100 0.024

Gene RIF (5)

PMID Text
22158615 DR4 and DR5 have a capability to activate Nox1 by recruiting RFK, resulting in ROS-mediated apoptotic cell death in tumor cells.
21308351 levels of riboflavin kinase expression correlate well with Gleason score, known as a good indicator of patient prognosis
20877624 Observational study of gene-disease association. (HuGE Navigator)
19641494 results suggest that TNF, through the activation of RFK, enhances the incorporation of FAD in NADPH oxidase enzymes, a critical step for the assembly and activation of NADPH oxidase
14580199 the structure of riboflavin kinase cocrystallized with both MgADP and FMN is reported; drastic conformational changes associated with flavin binding are observed primarily at the so-called Flap I and Flap II loop regions

AA Sequence

MRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPY      1 - 70
YKNTKKSMETHIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEHLKIKE     71 - 140
DNFFQVSKSKIMNGH                                                           141 - 155
//

Text Mined References (15)

PMID Year Title
22158615 2012 Death receptors 4 and 5 activate Nox1 NADPH oxidase through riboflavin kinase to induce reactive oxygen species-mediated apoptotic cell death.
21308351 2011 Involvement of riboflavin kinase expression in cellular sensitivity against cisplatin.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19641494 2009 Riboflavin kinase couples TNF receptor 1 to NADPH oxidase.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...