Property Summary

NCBI Gene PubMed Count 24
PubMed Score 28.71
PubTator Score 41.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Hereditary spherocytosis 16 3.787 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis 1.182 1.1e-02
fibroadenoma -1.400 1.6e-03
head and neck cancer -1.100 1.8e-02
interstitial cystitis 1.200 1.2e-03
invasive ductal carcinoma -1.600 1.2e-03
ovarian cancer -2.200 1.9e-09

Gene RIF (18)

AA Sequence

MRESALERGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRS      1 - 70
HDTTSNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQK     71 - 140
APEPLGPADQSELGPEQLEAEVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPP    141 - 210
RLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA                       211 - 261
//

Text Mined References (36)

PMID Year Title