Property Summary

NCBI Gene PubMed Count 22
Grant Count 3
R01 Count 3
Funding $306,139.5
PubMed Score 27.85
PubTator Score 41.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ulcerative colitis 1.800 0.000
fibroadenoma -1.400 0.002
interstitial cystitis 1.200 0.001
invasive ductal carcinoma -1.600 0.001
ovarian cancer -2.200 0.000
head and neck cancer -1.100 0.018

Synonym

Accession Q969G5
Symbols SRBC
HSRBC
CAVIN3
cavin-3

Gene

PANTHER Protein Class (1)

Gene RIF (17)

PMID Text
25588833 cavin3 is recruited to the caveolae coat by cavin1 to interact with caveolin1 and regulate the duration time of caveolae at the plasma membrane.
25052149 These results demonstrate that mucosal expression of PRKCDBP correlated strongly with TNF-alpha expression in UC patients and that infliximab therapy resulted in profound reductions in both PRKCDBP and TNF-alpha.
24473072 Rather than forming a single coat complex containing the three cavin family members, single-molecule analysis reveals an exquisite specificity of interactions between cavin1, cavin2 and cavin3.
24069528 in vivo consequences of cavin-3 knockout are increased lactate production and cachexia
23118876 we found loss at 11p15 to be a marker for triple-negative breast cancer and breast cancer brain metastases and PRKCDBP to be a potential target gene in this locus.
23020606 individuals with the variant homozygous CC genotype of PRKCDBP rs1051992 were at higher risk for developing endometrial cancer, but this genotype was a favorable prognostic factor once cancer was present
21980136 Data indicate that PRKCDBP expression was hardly detectable in 29 of 80 (36%) primary tumors and 11 of 19 (58%) cell lines.
21913217 The cavin family protein Polymerase 1 and transcript release factor, SRBC and serum deprivation response protein were down regulated in breast cancer cell lines and breast tumor tissue.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20423276 Our data demonstrate that epigenetic inactivation of hSRBC due to aberrant promoter hypermethylation is a common event and might be implicated in human ovarian tumorigenesis.
More...

AA Sequence

MRESALERGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRS      1 - 70
HDTTSNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQK     71 - 140
APEPLGPADQSELGPEQLEAEVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPP    141 - 210
RLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA                       211 - 261
//

Text Mined References (32)

PMID Year Title
25588833 2015 Cavin3 interacts with cavin1 and caveolin1 to increase surface dynamics of caveolae.
25416956 2014 A proteome-scale map of the human interactome network.
25052149 2014 Elevation of PRKCDBP, a novel transcriptional target of TNF-?, and its downregulation by infliximab in patients with ulcerative colitis.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24473072 2013 Single-molecule analysis reveals self assembly and nanoscale segregation of two distinct cavin subcomplexes on caveolae.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24069528 2013 Cavin-3 dictates the balance between ERK and Akt signaling.
24013648 2013 Molecular composition and ultrastructure of the caveolar coat complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23118876 2012 Clinical relevance of loss of 11p15 in primary and metastatic breast cancer: association with loss of PRKCDBP expression in brain metastases.
More...