Property Summary

NCBI Gene PubMed Count 52
PubMed Score 35.72
PubTator Score 30.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
ependymoma 4679 4.3e-09
pituitary cancer 1972 3.7e-05
osteosarcoma 7950 7.0e-05
group 3 medulloblastoma 4104 3.3e-03
ovarian cancer 8520 6.8e-03
glioblastoma 5792 1.2e-02
astrocytic glioma 2597 4.1e-02
spina bifida 1074 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 3.0

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 4.1e-02
ependymoma 1.300 4.3e-09
glioblastoma -1.400 1.2e-02
group 3 medulloblastoma 1.200 3.3e-03
osteosarcoma -2.294 7.0e-05
ovarian cancer -1.400 6.8e-03
pituitary cancer 1.700 3.7e-05
spina bifida -1.603 4.2e-02

 MGI Phenotype (1)

Gene RIF (22)

AA Sequence

MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPL      1 - 70
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYL     71 - 140
AYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSES    141 - 210
VVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEV    211 - 280
DMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEET    281 - 350
TESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE             351 - 411
//

Text Mined References (67)

PMID Year Title