Property Summary

NCBI Gene PubMed Count 30
PubMed Score 42.13
PubTator Score 38.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 6.2e-03
medulloblastoma, large-cell 2.500 1.7e-02
ovarian cancer -1.700 3.8e-07

Gene RIF (20)

AA Sequence

MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFS      1 - 70
RAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVC     71 - 140
KEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRA    141 - 210
KEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDV    211 - 280
TGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQ    281 - 350
TLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF                                  351 - 390
//

Text Mined References (32)

PMID Year Title