Property Summary

Ligand Count 119
NCBI Gene PubMed Count 95
PubMed Score 266.50
PubTator Score 214.45

Knowledge Summary

Patent (15,461)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -2.000 1.5e-02
Breast cancer 1.300 6.7e-03
ependymoma -1.800 4.8e-02
interstitial cystitis 1.100 1.6e-02
invasive ductal carcinoma 2.200 1.3e-03
non-small cell lung cancer 1.761 3.3e-09
oligodendroglioma -2.000 1.8e-02
pituitary cancer 1.700 8.3e-04
psoriasis -1.700 1.6e-07

Gene RIF (79)

AA Sequence

MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRH      1 - 70
KPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR     71 - 140
WYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLL    141 - 210
ALYLLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQ    211 - 280
LFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRR    281 - 350
PGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL                          351 - 398
//

Text Mined References (99)

PMID Year Title