Property Summary

NCBI Gene PubMed Count 90
Grant Count 163
R01 Count 77
Funding $15,285,616.72
PubMed Score 253.09
PubTator Score 214.45

Knowledge Summary

Patent (15,461)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -2.000 0.015
ependymoma -1.800 0.048
oligodendroglioma -2.000 0.018
non-small cell lung cancer 1.761 0.000
interstitial cystitis 1.100 0.016
Breast cancer 1.300 0.007
invasive ductal carcinoma 2.200 0.001
pituitary cancer 1.700 0.001
psoriasis -1.700 0.000

Synonym

Accession Q969F8 A5D8U2 B2RTV1 Q96QG0 KiSS-1R
Symbols HH8
CPPB1
GPR54
AXOR12
KISS-1R
HOT7T175

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (74)

PMID Text
26721186 KISS1R signaling induces invadopodia formation and activation of key invadopodia proteins, cortactin, cofilin and membrane type I matrix metalloproteases (MT1-MMP).
26572251 KiSS1 is a metastasis suppressor gene of pancreatic cancer, and this suppression is not dependent on the expression levels of GPR54.
26510589 A number of mutations in KISS1 KISS1R are associated with central precocious puberty and isolated hypogonadotropic hypogonadism. (Review)
26471489 KISS1R Low Expression Correlates with Colorectal Liver Metastasis.
26211894 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
26199944 Two novel heterozygous missense mutations in FGFR1 and one novel heterozygous missense mutation in KISS1R, were identified in in Chinese Kallmann Syndrome Males with Cleft Lip/Palate.
26010933 No KISS1R expression was detected in normal or malignant tissues or in liver metastases.
25667462 Decreased expression of KISS1R seems to attenuate signaling of the KISS1/KISS1R system, possibly leading to tumor growth
25535062 Present data do not confirm the protective role of KiSS1/KiSS1R in breast cancer progression, but our results do support the hypothesis that KiSS1/KiSS1R system is activated even in primary breast cancer and sustained during invasion to local lymph nodes.
25262569 Normosmic idiopathic hypogonadotropic hypogonadism due to a novel homozygous nonsense c.C969A (p.Y323X) mutation in the KISS1R gene in three unrelated families.
More...

AA Sequence

MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRH      1 - 70
KPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR     71 - 140
WYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLL    141 - 210
ALYLLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQ    211 - 280
LFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRR    281 - 350
PGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL                          351 - 398
//

Text Mined References (94)

PMID Year Title
26721186 2016 KISS1R signaling promotes invadopodia formation in human breast cancer cell via ?-arrestin2/ERK.
26572251 2016 KiSS?1?mediated suppression of the invasive ability of human pancreatic carcinoma cells is not dependent on the level of KiSS?1 receptor GPR54.
26510589 [Kisspeptin and leptin in the regulation of fertility].
26471489 2015 KISS1 Associates with Better Outcome via Inhibiting Matrix Metalloproteinase-9 in Colorectal Liver Metastasis.
26211894 2015 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
26199944 2015 Novel FGFR1 and KISS1R Mutations in Chinese Kallmann Syndrome Males with Cleft Lip/Palate.
26010933 2015 A clinicopathological analysis of KISS1 and KISS1R expression in colorectal cancer.
25667462 2015 The role of KISS1/KISS1R system in tumor growth and invasion of differentiated thyroid cancer.
25535062 2015 Immunohistochemical study of KiSS1 and KiSS1R expression in human primary breast cancer: Association with breast cancer receptor status, proliferation markers and clinicopathological features.
25262569 2015 Normosmic idiopathic hypogonadotropic hypogonadism due to a novel homozygous nonsense c.C969A (p.Y323X) mutation in the KISS1R gene in three unrelated families.
More...