Property Summary

NCBI Gene PubMed Count 22
PubMed Score 18.80
PubTator Score 15.61

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 6.33880160254584E-6
ovarian cancer 8492 0.00227841616164173
primary pancreatic ductal adenocarcinoma 1271 0.00794266155946121
fibroadenoma 557 0.0188078979885753
Disease Target Count Z-score Confidence
Hyperopia 33 3.053 1.5


  Differential Expression (4)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.026 0.008
fibroadenoma 1.800 0.019
lung adenocarcinoma -1.500 0.000
ovarian cancer 1.300 0.002


Accession Q969F2 Q96EK8 Q9BSN0 Naked-2
Symbols Naked2


  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG

 GWAS Trait (1)

Gene RIF (7)

26902120 NKD2 regulates osteosarcoma cell proliferation and apoptosis by inhibiting the Wnt signaling.MiR-130b targets NKD2 and regulates the Wnt signaling to promote proliferation and inhibit apoptosis of osteosarcoma cells.
26396173 NKD2 methylation is associated with cell differentiation, TNM stage and distant metastasis significantly (all P < 0.05), and the overall survival time is longer in NKD2 unmethylated group compared to NKD2 methylated group (P < 0.05).
26124080 NKD2 is frequently methylated in human breast cancer, and the expression of NKD2 is regulated by promoter region methylation.
20177058 NKD2 antagonizes Wnt signaling: myristoylated NKD2 interacts with Dvl-1 at the plasma membrane, and this interaction leads to their mutual ubiquitin-mediated proteasomal degradation.
18757723 identify an EGFR-independent action of TGF-alpha, in which it protects Naked2 from proteasomal degradation, thus ensuring its delivery to the basolateral surface of polarized epithelial cells
17553928 Naked2 acts as a cargo recognition and targeting (CaRT) protein to ensure proper delivery, tethering, and fusion of TGF-alpha-containing vesicles to a distinct region at the basolateral surface of polarized epithelial cells.
16752383 NKD2 represents a candidate target of 5p amplifications in soft tissue sarcomas and might play a crucial role during the progression of this disease.

AA Sequence

EGYAVPVIQRHEHHHHHEHHHHHHHHHFHPS                                           421 - 451

Text Mined References (23)

PMID Year Title
26902120 2016 miR-130b targets NKD2 and regulates the Wnt signaling to promote proliferation and inhibit apoptosis in osteosarcoma cells.
26396173 2015 Silencing NKD2 by promoter region hypermethylation promotes gastric cancer invasion and metastasis by up-regulating SOX18 in human gastric cancer.
26124080 2015 Epigenetic silencing of NKD2, a major component of Wnt signaling, promotes breast cancer growth.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20828404 2010 Convergence between Wnt-?-catenin and EGFR signaling in cancer.
20177058 2010 Myristoylated Naked2 antagonizes Wnt-beta-catenin activity by degrading Dishevelled-1 at the plasma membrane.
19847810 2010 Frequent promoter hypermethylation of Wnt pathway inhibitor genes in malignant astrocytic gliomas.
18757723 2008 EGF receptor-independent action of TGF-alpha protects Naked2 from AO7-mediated ubiquitylation and proteasomal degradation.