Property Summary

NCBI Gene PubMed Count 25
PubMed Score 19.72
PubTator Score 15.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
fibroadenoma 1.800 1.9e-02
lung adenocarcinoma -1.500 6.3e-06
ovarian cancer 1.300 2.3e-03
primary pancreatic ductal adenocarcinoma 1.026 7.9e-03

Gene RIF (10)

AA Sequence

MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELPNGDPKEGPFREDQCPLQVAL      1 - 70
PAEKAEGREHPGQLLSADDGERAANREGPRGPGGQRLNIDALQCDVSVEEDDRQEWTFTLYDFDNCGKVT     71 - 140
REDMSSLMHTIYEVVDASVNHSSGSSKTLRVKLTVSPEPSSKRKEGPPAGQDREPTRCRMEGELAEEPRV    141 - 210
ADRRLSAHVRRPSTDPQPCSERGPYCVDENTERRNHYLDLAGIENYTSRFGPGSPPVQAKQEPQGRASHL    211 - 280
QARSRSQEPDTHAVHHRRSQVLVEHVVPASEPAARALDTQPRPKGPEKQFLKSPKGSGKPPGVPASSKSG    281 - 350
KAFSYYLPAVLPPQAPQDGHHLPQPPPPPYGHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAG    351 - 420
EGYAVPVIQRHEHHHHHEHHHHHHHHHFHPS                                           421 - 451
//

Text Mined References (26)

PMID Year Title