Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.36
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Synonym

Accession Q969F1 Q5VXN2
Symbols C6orf51
TFIIIC35
bA397G5.3

Gene

AA Sequence

MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTL      1 - 70
GTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMI     71 - 140
CNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQ    141 - 210
MLP                                                                       211 - 213
//

Text Mined References (6)

PMID Year Title
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17409385 2007 Identification, molecular cloning, and characterization of the sixth subunit of human transcription factor TFIIIC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.